MAGEA1 Antibody (3H5) - Azide and BSA Free

Sandwich ELISA: MAGE 1 Antibody (3H5) [H00004100-M01] - Detection limit for recombinant GST tagged MAGEA1 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3H5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MAGEA1 Antibody (3H5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MAGEA1 (NP_004979, 98 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVL
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MAGEA1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAGEA1 Antibody (3H5) - Azide and BSA Free

• Antigen MZ2-E
• Cancer/testis antigen 1.1
• cancer/testis antigen family 1, member 1
• CT1.1
• CT1.1melanoma antigen family A 1
• MAGE-1 antigen
• MAGE1
• MAGE1A
• MAGE1melanoma antigen MAGE-1
• MAGEA1
• MAGE-A1
• melanoma antigen family A, 1 (directs expression of antigen MZ2-E)
• melanoma-associated antigen 1
• melanoma-associated antigen MZ2-E
• MGC9326
• MZ2-E

Background

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAGEA1
• Entrez:
  • 4100(Human)
• Uniprot:
  • NP_004979(Human)