MAF1 Antibody

Images

 
Western Blot: MAF1 Antibody [NBP2-32389] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Tonsil tissue
Immunocytochemistry/ Immunofluorescence: MAF1 Antibody [NBP2-32389] - Immunofluorescent staining of human cell line A549 shows localization to nucleus.
Immunohistochemistry-Paraffin: MAF1 Antibody [NBP2-32389] - Staining of human adrenal gland shows nuclear positivity in glandular cells.
Simple Western: MAF1 Antibody [NBP2-32389] - Simple Western lane view shows a specific band for MAF1 in 0.2 mg/ml of H. Tonsil and MOLT-4 lysate(s). This experiment was performed under reducing conditions using the ...read more
Simple Western: MAF1 Antibody [NBP2-32389] - Electropherogram image of the corresponding Simple Western lane view. MAF1 antibody was used at 1:25 dilution on H. Tonsil and MOLT-4 lysate(s) respectively.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QTSGLSPSRLSKSQGGEEEGPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLSWVVNAVNCSLF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAF1 Protein (NBP2-32389PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAF1 Antibody

  • DKFZp586G1123
  • homolog of yeast MAF1
  • MAF1 homolog (S. cerevisiae)
  • MGC20332
  • MGC31779
  • MGC39758
  • repressor of RNA polymerase III transcription MAF1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55335
Species: Hu
Applications: WB, ICC/IF
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-82210
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
49130002
Species: Ce
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32389
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for MAF1 Antibody (NBP2-32389) (0)

There are no publications for MAF1 Antibody (NBP2-32389).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAF1 Antibody (NBP2-32389) (0)

There are no reviews for MAF1 Antibody (NBP2-32389). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAF1 Antibody (NBP2-32389) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAF1 Products

Bioinformatics Tool for MAF1 Antibody (NBP2-32389)

Discover related pathways, diseases and genes to MAF1 Antibody (NBP2-32389). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAF1 Antibody (NBP2-32389)

Discover more about diseases related to MAF1 Antibody (NBP2-32389).
 

Pathways for MAF1 Antibody (NBP2-32389)

View related products by pathway.

PTMs for MAF1 Antibody (NBP2-32389)

Learn more about PTMs related to MAF1 Antibody (NBP2-32389).

Blogs on MAF1

There are no specific blogs for MAF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAF1