MAB21L2 Antibody

Immunocytochemistry/Immunofluorescence: MAB21L2 Antibody [NBP2-58093] - Staining of human cell line BJ shows localization to nucleoplasm. Antibody staining is shown in green.

Product Discontinued

MAB21L2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSE
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAB21L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAB21L2 Antibody

• FLJ31103
• mab-21 (C. elegans)-like 2
• mab-21-like 2 (C. elegans)
• protein mab-21-like 2

Background

The MAB21L2 gene is similar to the C. elegans MAB-21 cell fate-determining gene, a downstream target of transforming growthfactor-beta signaling. It is thought that this gene may be involved in neural development. The protein encoded by thisgene is primarily nuc

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAB21L2