MAB21L2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAB21L2 Antibody [NBP2-58093] - Staining of human cell line BJ shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAB21L2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSE
Specificity
Specificity of human MAB21L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAB21L2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MAB21L2 Antibody

  • FLJ31103
  • mab-21 (C. elegans)-like 2
  • mab-21-like 2 (C. elegans)
  • protein mab-21-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55246
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NB300-750
Species: Hu, Mu, Rt, Fi, Mk, Pm, Sh
Applications: WB, ICC/IF, IHC, IP, ICC
NBP2-61435
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005076-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
H00030062-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF650
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP1-90004
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84487
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56443
Species: Hu, Mu, Rt
Applications: WB
NB100-1218
Species: Hu, Rt
Applications: WB, Flow, IHC, IHC-P, IP, PEP-ELISA
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58093
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for MAB21L2 Antibody (NBP2-58093) (0)

There are no publications for MAB21L2 Antibody (NBP2-58093).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAB21L2 Antibody (NBP2-58093) (0)

There are no reviews for MAB21L2 Antibody (NBP2-58093). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAB21L2 Antibody (NBP2-58093) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAB21L2 Products

Bioinformatics Tool for MAB21L2 Antibody (NBP2-58093)

Discover related pathways, diseases and genes to MAB21L2 Antibody (NBP2-58093). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAB21L2 Antibody (NBP2-58093)

Discover more about diseases related to MAB21L2 Antibody (NBP2-58093).
 

Pathways for MAB21L2 Antibody (NBP2-58093)

View related products by pathway.

Research Areas for MAB21L2 Antibody (NBP2-58093)

Find related products by research area.

Blogs on MAB21L2

There are no specific blogs for MAB21L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAB21L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAB21L2