LZTS1 Antibody

Images

 
Western Blot: LZTS1 Antibody [NBP1-83907] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: LZTS1 Antibody [NBP1-83907] - Staining of human parathyroid gland shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LZTS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVSSLISGHSFHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKVSQKARGSHHPDYTALSSGDLGGQAGVDFDPSTP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LZTS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
LZTS1 Protein (NBP1-83907PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LZTS1 Antibody

  • F37
  • F37/esophageal cancer-related gene-coding leucine-zipper motifFez1
  • FEZ1leucine zipper putative tumor suppressor 1
  • leucine zipper, putative tumor suppressor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01086
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB7557
Species: Hu
Applications: WB, IHC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4366
Species: Hu, Mu, Rt
Applications: WB
NBL1-10680
Species: Hu
NBP2-01171
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90909
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-83907
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for LZTS1 Antibody (NBP1-83907) (0)

There are no publications for LZTS1 Antibody (NBP1-83907).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LZTS1 Antibody (NBP1-83907) (0)

There are no reviews for LZTS1 Antibody (NBP1-83907). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LZTS1 Antibody (NBP1-83907) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LZTS1 Products

Bioinformatics Tool for LZTS1 Antibody (NBP1-83907)

Discover related pathways, diseases and genes to LZTS1 Antibody (NBP1-83907). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LZTS1 Antibody (NBP1-83907)

Discover more about diseases related to LZTS1 Antibody (NBP1-83907).
 

Pathways for LZTS1 Antibody (NBP1-83907)

View related products by pathway.

PTMs for LZTS1 Antibody (NBP1-83907)

Learn more about PTMs related to LZTS1 Antibody (NBP1-83907).

Blogs on LZTS1

There are no specific blogs for LZTS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LZTS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LZTS1