LZTFL1 Antibody (1B1) - Azide and BSA Free

Western Blot: LZTFL1 Antibody (1B1) [H00054585-M09] - Analysis of LZTFL1 transfected lysate using anti-LZTFL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with LZTFL1 rabbit polyclonal antibody.

Western Blot: LZTFL1 Antibody (1B1) [H00054585-M09] - Analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody (M09), clone 1B1. Lane 1: LZTFL1 transfected lysatE (34.6 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 1B1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LZTFL1 Antibody (1B1) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse LZTFL1 Antibody (1B1) - Azide and BSA Free (H00054585-M09) is a monoclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LZTFL1 (AAH25988.1, 39 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENQELLEQVAEFEKA
• Specificity: LZTFL1 - leucine zipper transcription factor-like 1 (1B1)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LZTFL1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LZTFL1 Antibody (1B1) - Azide and BSA Free

• FLJ36386
• leucine zipper transcription factor-like 1
• leucine zipper transcription factor-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LZTFL1
• Entrez:
  • 54585(Human)
• Uniprot:
  • AAH25988(Human)