LZTFL1 Antibody (1B1)

Images

 
Western Blot: LZTFL1 Antibody (1B1) [H00054585-M09] - Analysis of LZTFL1 transfected lysate using anti-LZTFL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with LZTFL1 rabbit polyclonal antibody.
Western Blot: LZTFL1 Antibody (1B1) [H00054585-M09] - Analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody (M09), clone 1B1. Lane 1: LZTFL1 transfected lysatE (34.6 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
1B1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LZTFL1 Antibody (1B1) Summary

Immunogen
LZTFL1 (AAH25988.1, 39 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENQELLEQVAEFEKA
Specificity
LZTFL1 - leucine zipper transcription factor-like 1 (1B1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LZTFL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LZTFL1 Antibody (1B1)

  • FLJ36386
  • leucine zipper transcription factor-like 1
  • leucine zipper transcription factor-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-97655
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB179
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-92831
Species: Hu, Mu, Rt
Applications: WB, IHC
NLS2666
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
MAB1364
Species: Hu
Applications: Flow, CyTOF-ready
MAB8494
Species: Hu
Applications: WB, IHC, ICC
NBP1-89344
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NLS2666
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
NBP1-83907
Species: Hu
Applications: IHC, IHC-P
NBP2-46722
Species: Hu
Applications: IHC, IHC-P
AF3635
Species: Mu
Applications: WB, IHC
NBP1-84416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006944-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-86248
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-92876
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for LZTFL1 Antibody (H00054585-M09) (0)

There are no publications for LZTFL1 Antibody (H00054585-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LZTFL1 Antibody (H00054585-M09) (0)

There are no reviews for LZTFL1 Antibody (H00054585-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LZTFL1 Antibody (H00054585-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LZTFL1 Products

Bioinformatics Tool for LZTFL1 Antibody (H00054585-M09)

Discover related pathways, diseases and genes to LZTFL1 Antibody (H00054585-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LZTFL1 Antibody (H00054585-M09)

Discover more about diseases related to LZTFL1 Antibody (H00054585-M09).
 

Pathways for LZTFL1 Antibody (H00054585-M09)

View related products by pathway.

Blogs on LZTFL1

There are no specific blogs for LZTFL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LZTFL1 Antibody (1B1) and receive a gift card or discount.

Bioinformatics

Gene Symbol LZTFL1
Entrez
Uniprot