Home » LYK5 » LYK5 Antibodies » LYK5 Antibody

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

LYK5 Antibody

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related LYK5 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52980
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LYK5 Antibody Summary

Immunogen
Synthetic peptides corresponding to LYK5(protein kinase LYK5) The peptide sequence was selected from the C terminal of LYK5. Peptide sequence AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV.
Predicted Species
Mouse (100%), Rat (93%), Canine (93%), Sheep (93%), Equine (93%), Rabbit (100%), Bovine (93%), Guinea Pig (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STRADA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LYK5 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LYK5 Antibody

  • LYK5FLJ90524
  • NY-BR-96
  • protein kinase LYK5
  • Serologically defined breast cancer antigen NY-BR-96
  • STE20-like pseudokinase
  • STE20-related adapter protein
  • STE20-related adaptor protein
  • STE20-related kinase adapter protein alpha
  • STE20-related kinase adaptor alpha
  • Stlk
  • STRAD alpha
  • STRADPMSE

Background

LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11. It relocates STK11 from the nucleus to the cytoplasm and plays an essential role in STK11-mediated G1 cell cycle arrest.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LKB1/STK11
Antibody - BSA Free
NBP2-14835
Immunocytochemistry/ Immunofluorescence LKB1/STK11 Antibody - BSA Free
Western Blot LKB1/STK11 Antibody - BSA Free
Immunohistochemistry-Paraffin LKB1/STK11 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
CAB39 Antibody -
BSA Free
NBP2-15658
Western Blot CAB39 Antibody - BSA Free
Immunohistochemistry-Paraffin CAB39 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CAB39 Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AMPK alpha 2
Antibody [Unconjugate
AF2850
Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]
Western Blot AMPK alpha 2 Antibody [Unconjugated]
Simple Western AMPK alpha 2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AMPK alpha 1
Antibody (2B7) - BSA
NBP2-22127
Immunocytochemistry/ Immunofluorescence AMPK alpha 1 Antibody (2B7) - BSA Free
ELISA AMPK alpha 1 Antibody (2B7) - BSA Free
Simple Western AMPK alpha 1 Antibody (2B7) - BSA Free
(13 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AMPK beta 1
Antibody [Unconjugate
AF2854
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
Western Blot AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
TOR/mTOR [p
Ser2448] Antibody - B ...
NB600-607
Immunohistochemistry TOR/mTOR [p Ser2448] Antibody - BSA Free
Western Blot TOR/mTOR [p Ser2448] Antibody - BSA Free
Data TOR/mTOR [p Ser2448] Antibody - BSA Free
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
PAWR / PAR4
Antibody - BSA Free
NBP1-87338
Immunohistochemistry-Paraffin PAWR / PAR4 Antibody - BSA Free
Western Blot PAWR / PAR4 Antibody - BSA Free
Immunohistochemistry-Paraffin PAWR / PAR4 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MST3 Antibody -
BSA Free
NBP1-87833
Immunohistochemistry-Paraffin MST3 Antibody - BSA Free
Western Blot MST3 Antibody - BSA Free
Immunohistochemistry-Paraffin MST3 Antibody - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry PTEN Antibody [Unconjugated]
Western Blot PTEN Antibody [Unconjugated]
(18 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
TSC1 Antibody
(OTI3A2)
NBP2-46234
Immunohistochemistry TSC1 Antibody (OTI3A2)
Immunohistochemistry TSC1 Antibody (OTI3A2)
Immunohistochemistry TSC1 Antibody (OTI3A2)
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
SLC12A3 Antibody -
BSA Free
NBP1-44270
Western Blot SLC12A3 Antibody - BSA Free
Immunohistochemistry SLC12A3 Antibody - BSA Free
(1 Publication)
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, WB
GM130/GOLGA2
Antibody - BSA Free
NBP2-53420
Immunocytochemistry/ Immunofluorescence GM130/GOLGA2 Antibody - BSA Free
Flow Cytometry GM130/GOLGA2 Antibody - BSA Free
Western Blot GM130/GOLGA2 Antibody - BSA Free
(22 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
CRM1 Antibody -
BSA Free
NB100-79802
Western Blot CRM1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CRM1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CRM1 Antibody - BSA Free
(17 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
ALS2CR2 Antibody
NBP2-24680
Western Blot ALS2CR2 Antibody
Immunohistochemistry-Paraffin ALS2CR2 Antibody
Species: Bv, Ca, Eq, Hu, Pm
Applications: IHC,  IHC-P, WB
MARK1 Antibody -
BSA Free
NBP1-33409
Immunocytochemistry/ Immunofluorescence MARK1 Antibody - BSA Free
Western Blot MARK1 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, WB
MST4 Antibody -
BSA Free
NBP3-35679
Western Blot MST4 Antibody - BSA Free
Immunohistochemistry MST4 Antibody - BSA Free
Immunohistochemistry MST4 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
MARK2 [p Thr595]
Antibody - BSA Free
NBP1-78028
Western Blot MARK2 [p Thr595] Antibody - BSA Free
Western Blot MARK2 [p Thr595] Antibody - BSA Free
Western Blot MARK2 [p Thr595] Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB
TSC2 Antibody
(SC05-59)
NBP2-67552
Western Blot TSC2 Antibody (SC05-59)
Immunohistochemistry-Paraffin TSC2 Antibody (SC05-59)
Flow Cytometry TSC2 Antibody (SC05-59)
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB

Publications for LYK5 Antibody (NBP1-52980) (0)

There are no publications for LYK5 Antibody (NBP1-52980).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYK5 Antibody (NBP1-52980) (0)

There are no reviews for LYK5 Antibody (NBP1-52980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYK5 Antibody (NBP1-52980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LYK5 Products

Research Areas for LYK5 Antibody (NBP1-52980)

Find related products by research area.

Blogs on LYK5

There are no specific blogs for LYK5, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYK5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol STRADA
Uniprot