LTV1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LTV1 Antibody [NBP1-86733] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: LTV1 Antibody [NBP1-86733] - Staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LTV1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ATGEEEGMDIQKSENEDDSEWEDVDDEKGDSNDDYDSAGLLSDEDCMSVPGKTHRAIADHLFWSEETKSRFTEYSM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LTV1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LTV1 Protein (NBP1-86733PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LTV1 Antibody

  • C6orf93
  • chromosome 6 open reading frame 93
  • dJ468K18.4
  • FLJ14909
  • FLJ18519
  • LTV1 homolog (S. cerevisiae)
  • protein LTV1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13663
Species: Hu
Applications: IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45960
Species: Hu, Mu, Mk
Applications: WB, IHC, IF
NBP1-84619
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58953
Species: Hu
Applications: ICC/IF
NBP2-30659
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-586
Species: Hu
Applications: WB, IP
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-98594
Species: Hu
Applications: WB
NBP1-91669
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056902-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP2-38152
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-56218
Species: Hu
Applications: ICC/IF
H00054957-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80801
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86733
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LTV1 Antibody (NBP1-86733) (0)

There are no publications for LTV1 Antibody (NBP1-86733).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LTV1 Antibody (NBP1-86733) (0)

There are no reviews for LTV1 Antibody (NBP1-86733). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LTV1 Antibody (NBP1-86733) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LTV1 Products

Bioinformatics Tool for LTV1 Antibody (NBP1-86733)

Discover related pathways, diseases and genes to LTV1 Antibody (NBP1-86733). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LTV1 Antibody (NBP1-86733)

Discover more about diseases related to LTV1 Antibody (NBP1-86733).
 

Pathways for LTV1 Antibody (NBP1-86733)

View related products by pathway.

PTMs for LTV1 Antibody (NBP1-86733)

Learn more about PTMs related to LTV1 Antibody (NBP1-86733).

Blogs on LTV1

There are no specific blogs for LTV1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LTV1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LTV1