Recombinant Human LTC4S GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human LTC4S Protein [H00004056-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human LTC4S GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 150 of Human LTC4S full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
LTC4S
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LTC4S GST (N-Term) Protein

  • EC 4.4.1.20
  • leukotriene C4 synthase
  • Leukotriene-C(4) synthase
  • LTC4 synthase
  • MGC33147

Background

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-80465
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB300-891
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NLS1317
Species: Hu, Pm, Pm
Applications: Flow, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-89330
Species: Hu
Applications: IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-82653
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80410
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
NBP2-75573
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LTC4S Recombinant Protein (H00004056-P01) (0)

There are no publications for LTC4S Recombinant Protein (H00004056-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LTC4S Recombinant Protein (H00004056-P01) (0)

There are no reviews for LTC4S Recombinant Protein (H00004056-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LTC4S Recombinant Protein (H00004056-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional LTC4S Products

Bioinformatics Tool for LTC4S Recombinant Protein (H00004056-P01)

Discover related pathways, diseases and genes to LTC4S Recombinant Protein (H00004056-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LTC4S Recombinant Protein (H00004056-P01)

Discover more about diseases related to LTC4S Recombinant Protein (H00004056-P01).
 

Pathways for LTC4S Recombinant Protein (H00004056-P01)

View related products by pathway.

PTMs for LTC4S Recombinant Protein (H00004056-P01)

Learn more about PTMs related to LTC4S Recombinant Protein (H00004056-P01).

Blogs on LTC4S.

Antibody treatment can generate microglia-like cells from bone marrow
By Jennifer Sokolowski, MD, PhD.Microglia play important roles in the brain in both homeostatic and pathological conditions, acting to clear debris and dying cells. There is evidence to suggest that microglial dys...  Read full blog post.

Customers Who Bought This Also Bought

IL-13 [HRP]
M1300CB
COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LTC4S GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LTC4S