LTBP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LTBP3 Antibody [NBP2-57788] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LTBP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AGKGYHILTSHQTLTIQGESDFSLFLHPDGPPKPQQLPESPSQAPPPEDTEEERGVTTDSPVSEERSVQQSHPTATTTPARPYPELISRPSPPTMRWFLPDLPPSRSAVEIAPTQVTETDECRL
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LTBP3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LTBP3 Recombinant Protein Antigen (NBP2-57788PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LTBP3 Antibody

  • latent transforming growth factor beta binding protein 3
  • LTBP2
  • LTBP-3
  • pp6425
  • STHAG6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2885
Species: Mu
Applications: WB
7754-BH/CF
Species: Hu
Applications: BA
NB110-8146
Species: Bv, Fe, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IM, WB
NBP2-24722
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
H00000053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-67635
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IP, WB
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88169
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP3-15841
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for LTBP3 Antibody (NBP2-57788) (0)

There are no publications for LTBP3 Antibody (NBP2-57788).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LTBP3 Antibody (NBP2-57788) (0)

There are no reviews for LTBP3 Antibody (NBP2-57788). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LTBP3 Antibody (NBP2-57788) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LTBP3 Products

Bioinformatics Tool for LTBP3 Antibody (NBP2-57788)

Discover related pathways, diseases and genes to LTBP3 Antibody (NBP2-57788). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LTBP3 Antibody (NBP2-57788)

Discover more about diseases related to LTBP3 Antibody (NBP2-57788).
 

Pathways for LTBP3 Antibody (NBP2-57788)

View related products by pathway.

PTMs for LTBP3 Antibody (NBP2-57788)

Learn more about PTMs related to LTBP3 Antibody (NBP2-57788).

Blogs on LTBP3

There are no specific blogs for LTBP3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LTBP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LTBP3