LSM6 Antibody (4B5-1B10) - Azide and BSA Free

Western Blot: LSM6 Antibody (4B5-1B10) [H00011157-M01] - Analysis of LSM6 expression in transfected 293T cell line by LSM6 monoclonal antibody (M01), clone 4B5-1B10.Lane 1: LSM6 transfected lysate(9.1 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: LSM6 Antibody (4B5-1B10) [H00011157-M01] - Analysis of monoclonal antibody to LSM6 on HeLa cell . Antibody concentration 10 ug/ml.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 4B5-1B10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LSM6 Antibody (4B5-1B10) - Azide and BSA Free Summary

• Immunogen: LSM6 (AAH16026, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM
• Localization: Nuclear
• Specificity: LSM6 - LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LSM6
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LSM6 Antibody (4B5-1B10) - Azide and BSA Free

• LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• Sm protein F
• U6 snRNA-associated Sm-like protein LSm6
• YDR378C

Background

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LSM6
• Entrez:
  • 11157(Human)
• OMIM:
  • 607286(Human)
• Uniprot:
  • AAH16026(Human)