Home » LSM6 » LSM6 Antibodies » LSM6 Antibody (4B5-1B10)

LSM6 Antibody (4B5-1B10)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: LSM6 Antibody (4B5-1B10) [H00011157-M01] - Analysis of LSM6 expression in transfected 293T cell line by LSM6 monoclonal antibody (M01), clone 4B5-1B10.Lane 1: LSM6 transfected lysate(9.1 KDa).Lane 2: Non-transfected lysate.
Western Blot: LSM6 Antibody (4B5-1B10) [H00011157-M01] - Analysis of LSM6 expression in transfected 293T cell line by LSM6 monoclonal antibody (M01), clone 4B5-1B10.Lane 1: LSM6 transfected lysate(9.1 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: LSM6 Antibody (4B5-1B10) [H00011157-M01] - Analysis of monoclonal antibody to LSM6 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4B5-1B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

LSM6 Antibody (4B5-1B10) Summary

Immunogen
LSM6 (AAH16026, 1 a.a. ~ 81 a.a) full length recombinant protein with GST tag.MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMN IALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM
Localization
Nuclear
Specificity
LSM6 - LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LSM6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LSM6 Antibody (4B5-1B10)

  • LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
  • Sm protein F
  • U6 snRNA-associated Sm-like protein LSm6
  • YDR378C

Background

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LSM2 Antibody
NBP2-38093
Western Blot: LSM2 Antibody [NBP2-38093] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: LSM2 Antibody [NBP2-38093] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LSM2 Antibody [NBP2-38093] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
LSM4 Antibody
NBP1-86846
Western Blot: LSM4 Antibody [NBP1-86846] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: LSM4 Antibody [NBP1-86846] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
LSM5 Antibody
NBP1-92082
Western Blot: LSM5 Antibody [NBP1-92082] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: LSM5 Antibody [NBP1-92082] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
SNRPN Antibody
NBP2-20439
Western Blot: SNRPN Antibody [NBP2-20439] - Sample (50 ug of whole cell lysate) A: Mouse Heart, 12% SDS PAGE gel, diluted at 1:500.
Western Blot: SNRPN Antibody [NBP2-20439] - Sample (30 ug of whole cell lysate) A: JurKat 12% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
SNRPD1 Antibody
NBP2-36427
Western Blot: SNRPD1 Antibody - Analysis in Rodent material: Recommended conditions: Dilution: 1:100 - 1:500 Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).
Immunohistochemistry-Paraffin: SNRPD1 Antibody - Staining of human kidney shows strong nuclear positivity in cells of tubules.
Western Blot: SNRPD1 Antibody - Analysis in Rodent material: Recommended conditions: Dilution: 1:100 - 1:250 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
LSM3 Antibody
NBP2-14206
Immunocytochemistry/Immunofluorescence: LSM3 Antibody [NBP2-14206] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: LSM3 Antibody [NBP2-14206] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
LSM7 Antibody
NBP1-92084
Immunocytochemistry/Immunofluorescence: LSM7 Antibody [NBP1-92084] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LSM7 Antibody [NBP1-92084] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus duct.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
eIF4A2 Antibody
NBP2-24529
Western Blot: eIF4A2 Antibody [NBP2-24529] - analysis of eIF4A2 in Jurkat cell lysate in the 1) absence, 2) presence of immunizing peptide and 3) 3T3 cell lysate using eIF4A2 antibody at 0.05 ug/ml, 0.05 ug/ml and 0.025 ug/ml, respectively.
Immunohistochemistry-Paraffin: eIF4A2 Antibody [NBP2-24529] - Formalin-fixed, paraffin-embedded human small intestine stained with eIF4A2 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Simple Western: eIF4A2 Antibody [NBP2-24529] - Simple Western lane view shows a specific band for Eif4a2 in 0.5 mg/ml of NIH-3T3 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
SSB Antibody
NBP1-33549
Western Blot: SSB Antibody [NBP1-33549] - Sample (30 ug of whole cell lysate) A: 293T 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SSB Antibody [NBP1-33549] - Analysis of paraformaldehyde-fixed A431, using SSB (NBP1-33549) antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: SSB Antibody [NBP1-33549] - Paraffin-embedded mouse fore brain. SSB antibody dilution: 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
SNRPD2 Antibody
NBP1-87028
Western Blot: SNRPD2 Antibody [NBP1-87028] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SNRPD2 Antibody [NBP1-87028] - Staining of human stomach shows strong nuclear positivity in glandular cells.
Western Blot: SNRPD2 Antibody [NBP1-87028] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
SNRPB Antibody
NBP2-56420
Western Blot: SNRPB Antibody [NBP2-56420] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: SNRPB Antibody [NBP2-56420] - Staining of human cell line HEK 293 shows localization to nucleoplasm.
Species: Hu
Applications: WB, ICC/IF
SLC36A1 Antibody
NBP2-30037
Western Blot: SLC36A1 Antibody [NBP2-30037] - Western blot analysis in NCI-H460(lane 1),K562(lane 2),A549(lane 3) cell line lysates (35ug/lane).This demonstrates the SLC36A1 antibody detected the SLC36A1 protein (arrow).
Immunocytochemistry/Immunofluorescence: SLC36A1 Antibody [NBP2-30037] - Confocal immunofluorescent analysis of (N-term) with NCI-H460 cell followed by Alexa Fluor 488-conjugated goat anti-rabbit lgG (green). Actin filaments have been labeled with Alexa Fluor 555 phalloidin (red).DAPI was used to stain the cell nuclear (blue).
Immunohistochemistry-Paraffin: SLC36A1 Antibody [NBP2-30037] - Immunohistochemistry analysis in formalin fixed and paraffin embedded human rectum tissue followed by peroxidase conjugation of the secondary antibody and DAB staining.This data demonstrates the use of (N-term) for immunohistochemistry. Clinical relevance has not been evaluated.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
AMPK alpha 1
Antibody
NB100-239
Western Blot: AMPK alpha 1 Antibody [NB100-239] - Extracts from 1. bovine aortic endothelial cells, 2. rat aortic smooth muscle cells, 3. HepG2 cells, or 4. human aortic endothelial cells. Antibody used at 2 ug/ml.
Immunohistochemistry-Paraffin: AMPK alpha 1 Antibody [NB100-239] - Human muscle; Antibody used at a dilution of 1:5,000 (0.2ug/ml).
(1 Review)
(12 Publications)
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
LSM1 Antibody
(OTI5C6)
NBP2-00918
Western Blot: LSM1 Antibody (5C6) [NBP2-00918] Analysis of extracts (35ug) from 9 different cell lines by using anti-LSM1 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: LSM1 Antibody (5C6) [NBP2-00918] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY LSM1.
Immunohistochemistry-Paraffin: LSM1 Antibody (5C6) [NBP2-00918] - Staining of paraffin-embedded Human Kidney tissue using anti-LSM1 mouse monoclonal antibody.
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
APPBP2 Antibody
NBP2-15432
Western Blot: APPBP2 Antibody [NBP2-15432] - Sample (30 ug of whole cell lysate) A: Jurkat 7.5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: APPBP2 Antibody [NBP2-15432] - Analysis of methanol-fixed HeLa, using antibody at 1:100 dilution.
Immunohistochemistry-Paraffin: APPBP2 Antibody [NBP2-15432] - Paraffin-embedded Ca922 xenograft, using antibody at 1:100 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Niemann-Pick C1
Antibody
NB400-148
Western Blot: Niemann-Pick C1 Antibody [NB400-148] - Hela lysate, BHK lysate, A431 lysate tested at 1:1000. Image provided by verified customer review.
Immunocytochemistry/Immunofluorescence: Niemann-Pick C1 Antibody [NB400-148] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-Niemann-Pick C1 at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Niemann-Pick C1 Antibody [NB400-148] - Staining of human brain, cortex, neurons and astrocytes.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
SMN Antibody (2B1)
NB100-1936
Western Blot: SMN Antibody (2B1) [NB100-1936] - Western blot analysis of SMN expression in 1) HeLa, 2) NTera2, 3) HepG2, 4) MCF7, 5) NIH 3T3, 6) PC12 and 7) COS7 whole cell lysates.
Immunocytochemistry/Immunofluorescence: SMN Antibody (2B1) [NB100-1936] - The SMN antibody was tested at a 1:250 dilution in HeLa cells against Dylight 488 (Green). Actin nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry: SMN Antibody (2B1) [NB100-1936] - Immunohistochemical analysis of SMN on mouse brain using NB100-1936.
(19 Publications)
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
SMN2 Antibody
(2B11-2A9)
H00006607-M01
Western Blot: SMN2 Antibody (2B11-2A9) [H00006607-M01] - SMN2 monoclonal antibody (M01), clone 2B11-2A9 Analysis of SMN2 expression in IMR-32.
Immunocytochemistry/Immunofluorescence: SMN2 Antibody (2B11-2A9) [H00006607-M01] - Analysis of monoclonal antibody to SMN2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: SMN2 Antibody (2B11-2A9) [H00006607-M01] - Analysis of monoclonal antibody to SMN2 on formalin-fixed paraffin-embedded human heart tissue. Antibody concentration 1 ~ 10 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
LHR Antibody
NLS1436
Immunohistochemistry-Paraffin: LHR Antibody [NLS1436] - IHC of human Breast, Carcinoma. Formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: LHR Antibody [NLS1436] - Analysis of anti-LHR receptor antibody with the middle size antral follicle (1.5 mm) of human ovary. Image from confirmed customer review.
Immunohistochemistry-Paraffin: LHR Antibody [NLS1436] - Analysis of anti-LHR receptor antibody with human ovary, corpus luteum at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC-P

Publications for LSM6 Antibody (H00011157-M01) (0)

There are no publications for LSM6 Antibody (H00011157-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSM6 Antibody (H00011157-M01) (0)

There are no reviews for LSM6 Antibody (H00011157-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LSM6 Antibody (H00011157-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LSM6 Products

Bioinformatics Tool for LSM6 Antibody (H00011157-M01)

Discover related pathways, diseases and genes to LSM6 Antibody (H00011157-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSM6 Antibody (H00011157-M01)

Discover more about diseases related to LSM6 Antibody (H00011157-M01).
 

Pathways for LSM6 Antibody (H00011157-M01)

View related products by pathway.

Blogs on LSM6

There are no specific blogs for LSM6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LSM6 Antibody (4B5-1B10) and receive a gift card or discount.


Bioinformatics

Gene Symbol LSM6
Entrez
OMIM
Uniprot