LSM6 Antibody (4B5-1B10)

Images

 
Western Blot: LSM6 Antibody (4B5-1B10) [H00011157-M01] - Analysis of LSM6 expression in transfected 293T cell line by LSM6 monoclonal antibody (M01), clone 4B5-1B10.Lane 1: LSM6 transfected lysate(9.1 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: LSM6 Antibody (4B5-1B10) [H00011157-M01] - Analysis of monoclonal antibody to LSM6 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4B5-1B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LSM6 Antibody (4B5-1B10) Summary

Immunogen
LSM6 (AAH16026, 1 a.a. ~ 81 a.a) full length recombinant protein with GST tag.MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMN IALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM
Localization
Nuclear
Specificity
LSM6 - LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LSM6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LSM6 Antibody (4B5-1B10)

  • LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
  • Sm protein F
  • U6 snRNA-associated Sm-like protein LSm6
  • YDR378C

Background

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86846
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92082
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-36427
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14206
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-92084
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87028
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56420
Species: Hu
Applications: WB, ICC/IF
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-00918
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NLS1436
Species: Hu
Applications: IHC-P

Publications for LSM6 Antibody (H00011157-M01) (0)

There are no publications for LSM6 Antibody (H00011157-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSM6 Antibody (H00011157-M01) (0)

There are no reviews for LSM6 Antibody (H00011157-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LSM6 Antibody (H00011157-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LSM6 Products

Bioinformatics Tool for LSM6 Antibody (H00011157-M01)

Discover related pathways, diseases and genes to LSM6 Antibody (H00011157-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSM6 Antibody (H00011157-M01)

Discover more about diseases related to LSM6 Antibody (H00011157-M01).
 

Pathways for LSM6 Antibody (H00011157-M01)

View related products by pathway.

Blogs on LSM6

There are no specific blogs for LSM6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LSM6 Antibody (4B5-1B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol LSM6
Entrez
OMIM
Uniprot