New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » LSM14B » LSM14B Antibodies » LSM14B Antibody

LSM14B Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: LSM14B Antibody [NBP2-87753] - Host: Rabbit. Target Name: LSM14B. Sample Type: Fetal Brain lysates. Antibody Dilution: 1.0ug/ml
Western Blot: LSM14B Antibody [NBP2-87753] - Host: Rabbit. Target Name: LSM14B. Sample Type: Fetal Brain lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

LSM14B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN LSM14B. Peptide sequence: GPLAASSLLSQQYAASLGLEKLVSPPASAAASSPSSSPSPQPVSELDLSS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
LSM14B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LSM14B Antibody

  • bA11M20.3
  • C20orf40
  • FAM61B
  • FT005
  • LSM13
  • LSM14B LSM14B, SCD6 homolog B (S. cerevisiae)
  • RAP55B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LSM14A Antibody
NBP1-88473
Western Blot: LSM14A Antibody [NBP1-88473] - Analysis in human cell line Daudi.
Immunohistochemistry-Paraffin: LSM14A Antibody [NBP1-88473] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LSM14A Antibody [NBP1-88473] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DDX6 Antibody
NB200-191
Immunoprecipitation: DDX6 Antibody [NB200-191] - Detection of human DDX6 by Western Blot and Immunoprecipitation. Samples: Whole cell lysate (15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-DDX6 antibody NB200-191 used at 0.04 ug/ml for WB (A and B) and at 3 ug/mg lysate for IP. DDX6 was also immunoprecipitated using rabbit anti-DDX6 antibody NB200-192, but not with 'DDX6 Ab', which is to another epitope from DDX6. Normal rabbit IgG was used as a negative control. Detection: Chemiluminescence with an exposure time of 1 second (A & B).
Immunohistochemistry-Paraffin: DDX6 Antibody [NB200-191] - Section of human colon carcinoma (left) and mouse renal cell carcinoma(right). Antibody: Affinity purified rabbit anti-DDX6 used at a dilution of 1:200 (1ug/ml). Detection: DAB.
Immunocytochemistry/Immunofluorescence: DDX6 Antibody [NB200-191] - In normal condition, cells were fixed and stained for DDX6, that usually punctuate in process bodies (PBs). Primary Antibody rabbit-anti-DDX6 diluted 1:1000. Image submitted by a verified customer review.
(1 Review)
(38 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Splicing factor,
arginine/serine-rich ...
NBP1-87381
Immunohistochemistry-Paraffin: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-87381] - Analysis in human endometrium and pancreas tissues. Corresponding RNA-seq data are presented for the same tissues.
Western Blot: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-87381] - Analysis in control (vector only transfected HEK293T lysate) and SRSF11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-87381] - Staining of human endometrium shows moderate to strong nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RNPC3 Antibody
NBP2-93867
Western Blot: RNPC3 Antibody [NBP2-93867] - Analysis of extracts of various cell lines, using RNPC3 . Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: WB
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin: Insulin Receptor beta Antibody [NBP2-12793] - Staining shows expression of insulin receptor beta in the Cortex in mouse brain. Dilution 1:500. Image submitted by a verified customer review.
Immunoprecipitation: Insulin Receptor beta Antibody [NBP2-12793] - Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug), Jurkat (J; 50 ug) and mouse NIH3T3 (M; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Insulin Receptor Beta antibody NBP2-12793 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate. Insulin Receptor Beta was also immunoprecipitated by rabbit anti-Insulin Receptor Beta antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A and B).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
MKP-3/DUSP6
Antibody (3G2)
H00001848-M01
Western Blot: MKP-3/DUSP6 Antibody (3G2) [H00001848-M01] - Analysis of DUSP6 expression in transfected 293T cell line by DUSP6 monoclonal antibody (M01), clone 3G2.Lane 1: DUSP6 transfected lysate(42 KDa).Lane 2: Non-transfected lysate.
Western Blot: MKP-3/DUSP6 Antibody (3G2) [H00001848-M01] - DUSP6 monoclonal antibody (M01), clone 3G2 Western Blot analysis of DUSP6 expression in Jurkat ( Cat # L017V1 ).
Western Blot: MKP-3/DUSP6 Antibody (3G2) [H00001848-M01] - DUSP6 monoclonal antibody (M01), clone 3G2. Western Blot analysis of DUSP6 expression in human placenta.
(4 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
SRGAP3 Antibody
NBP1-88831
Western Blot: SRGAP3 Antibody [NBP1-88831] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human pancreas shows low expression as expected.
(1 Publication)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
TACC1 Antibody
(OTI1H2)
NBP2-46057
Immunohistochemistry: TACC1 Antibody (1H2) [NBP2-46057] - Analysis of Carcinoma of Human kidney tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Western Blot: TACC1 Antibody (1H2) [NBP2-46057] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TACC1.
Immunohistochemistry: TACC1 Antibody (1H2) [NBP2-46057] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu
Applications: IHC, WB
SLC36A1 Antibody
NBP2-80524
SLC36A1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NRAS Antibody
(6S6F3)
NBP3-16473
Immunocytochemistry/Immunofluorescence: NRAS Antibody (6S6F3) [NBP3-16473] - Immunofluorescence analysis of U-2 OS cells using NRAS Rabbit mAb (NBP3-16473) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Western blot analysis of extracts of various cell lines, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Western blot analysis of extracts of Rat lung, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
ASCC2 Antibody
(OTI1E8) - Azide and ...
NBP2-72273
Western Blot: ASCC2 Antibody (OTI1E8) - Azide and BSA Free [NBP2-72273] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ASCC2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ASCC2.
Flow Cytometry: ASCC2 Antibody (OTI1E8) - Azide and BSA Free [NBP2-72273] - Analysis of Hela cells, using anti-ASCC2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Immunocytochemistry/Immunofluorescence: ASCC2 Antibody (OTI1E8) - Azide and BSA Free [NBP2-72273] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY ASCC2.
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
p57 Kip2 Antibody
NBP1-89917
Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining in human placenta and colon tissues using anti-CDKN1C antibody. Corresponding CDKN1C RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Histone
H2AY/macroH2A.1 Antib ...
NBP2-75523
Immunocytochemistry/Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (JU22-83) [NBP2-75523] - Staining macroH2A.1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (JU22-83) [NBP2-75523] - Staining macroH2A.1 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (JU22-83) [NBP2-75523] - Staining macroH2A.1 in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
APPBP2 Antibody -
BSA Free
NBP2-81781
Western Blot: APPBP2 Antibody [NBP2-81781] - Analysis of APPBP2 in human brain tissue lysate with APPBP2 antibody at (A) 0.5 and (B) 1 ug/ml.
Immunohistochemistry-Paraffin: APPBP2 Antibody [NBP2-81781] - APPBP2 in human brain tissue with APPBP2 antibody at 5 ug/mL.
Immunocytochemistry/Immunofluorescence: APPBP2 Antibody [NBP2-81781] - Immunofluorescence of APPBP2 in human brain tissue with APPBP2 antibody at 20 ug/mL.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SRGAP2 Antibody
NBP1-88830
Immunocytochemistry/Immunofluorescence: SRGAP2 Antibody [NBP1-88830] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SRGAP2 Antibody [NBP1-88830] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SRGAP2 Antibody [NBP1-88830] - Staining of human skin shows moderate cytoplasmic positivity in keratinocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TPX2 Antibody
NB500-179
Flow Cytometry: TPX2 Antibody [NB500-179] - RHAMM is not a cell surface but an intracellular cytoskeletal protein in mouse embryonic stem (ES) cells. (C) Alcohol permeabilized mouse ES cells, however, were strongly positive for both RHAMM and the intracellular positive control protein TPX2 (right panel). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0073548) licensed under a CC-BY licence.
Simple Western: TPX2 Antibody [NB500-179] - Lane view shows a specific band for TPX2 using HeLa cell lysate and antibody at 1:250. Electropherogram image of corresponding Simple Western lane view. Image reported by internal validation.
Immunocytochemistry/Immunofluorescence: TPX2 Antibody [NB500-179] - Staining of HeLa cells fixed in 3.5% paraformaldehyde using NB 500-179 (1:1,000). Nuclear staining during interphase and spindle staining during mitosis.
(1 Review)
(41 Publications)
Species: Hu, Ma, Mu, Po, Rt
Applications: Flow, ICC/IF, IP, KD, Simple Western, WB
Ets-1 Antibody
[Unconjugated]
AF7284
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, human thymus tissue, mouse thymus tissue, and rat CD4+ T cells. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human/Mouse/Rat Ets-1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7284) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Ets-1 at approximately 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Ets‑1 was detected in immersion fixed paraffin-embedded sections of human ovary using Sheep Anti-Human/Mouse/Rat Ets‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7284) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Sheep IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC006). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in epithelial cells. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Species: Hu, Mu, Rt
Applications: IHC, WB
LSM14B Antibody
NBP2-87753
LSM14B Antibody
Species: Hu
Applications: WB

Publications for LSM14B Antibody (NBP2-87753) (0)

There are no publications for LSM14B Antibody (NBP2-87753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSM14B Antibody (NBP2-87753) (0)

There are no reviews for LSM14B Antibody (NBP2-87753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LSM14B Antibody (NBP2-87753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LSM14B Products

Bioinformatics Tool for LSM14B Antibody (NBP2-87753)

Discover related pathways, diseases and genes to LSM14B Antibody (NBP2-87753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSM14B Antibody (NBP2-87753)

Discover more about diseases related to LSM14B Antibody (NBP2-87753).

Blogs on LSM14B

There are no specific blogs for LSM14B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LSM14B Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LSM14B