LRRTM1 Antibody

Images

 
Western Blot: LRRTM1 Antibody [NBP1-69331] - This Anti-LRRTM1 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRTM1 Antibody Summary

Immunogen
Synthetic peptides corresponding to LRRTM1(leucine rich repeat transmembrane neuronal 1) The peptide sequence was selected from the middle region of LRRTM1. Peptide sequence CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRTM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LRRTM1 and was validated on Western blot.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LRRTM1 Antibody

  • FLJ32082
  • leucine rich repeat transmembrane neuronal 1
  • leucine-rich repeat transmembrane neuronal 1 protein
  • leucine-rich repeat transmembrane neuronal protein 1
  • LRRTM1

Background

LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5589
Species: Hu, Mu
Applications: WB, IHC
AF4340
Species: Hu, Rt
Applications: WB, IHC
NBP2-42200
Species: Rt
Applications: WB, ICC/IF, IHC, ICC
H00001496-B01P
Species: Hu, Rt
Applications: WB
NBL1-14149
Species: Hu
AF4898
Species: Hu, Mu
Applications: WB, IHC
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31736
Species: Hu
Applications: IHC, IHC-P
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF7384
Species: Hu
Applications: ICC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-41299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5377
Species: Hu
Applications: WB
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-69331
Species: Hu
Applications: WB

Publications for LRRTM1 Antibody (NBP1-69331) (0)

There are no publications for LRRTM1 Antibody (NBP1-69331).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRTM1 Antibody (NBP1-69331) (0)

There are no reviews for LRRTM1 Antibody (NBP1-69331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRTM1 Antibody (NBP1-69331) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRTM1 Products

Bioinformatics Tool for LRRTM1 Antibody (NBP1-69331)

Discover related pathways, diseases and genes to LRRTM1 Antibody (NBP1-69331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRTM1 Antibody (NBP1-69331)

Discover more about diseases related to LRRTM1 Antibody (NBP1-69331).
 

Pathways for LRRTM1 Antibody (NBP1-69331)

View related products by pathway.

Blogs on LRRTM1

There are no specific blogs for LRRTM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRTM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRTM1
Entrez
Uniprot