![Western Blot: LRRFIP2 Antibody [NBP3-15516] - Analysis of extracts of various cell lines, using LRRFIP2 Rabbit pAb (NBP3-15516) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.](http://images.novusbio.com/fullsize/LRRFIP2-Antibody-Western-Blot-NBP3-15516-img0002.jpg "Western Blot: LRRFIP2 Antibody [NBP3-15516] - Analysis of extracts of various cell lines, using LRRFIP2 Rabbit pAb (NBP3-15516) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit LRRFIP2 Antibody - Azide and BSA Free (NBP3-15516) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 150-340 of human LRRFIP2 (NP_060194.1). VIEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELIEKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLESAGEGPLDVRLRKLAGEKEELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIEMQRDANRQISEYKFKLSKAEQDITTLEQSISRLEGQVLRY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LRRFIP2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LRRFIP2 Antibody (NBP3-15516)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LRRFIP2 |
![Immunocytochemistry/Immunofluorescence: LRRFIP2 Antibody [NBP3-15516] - Immunofluorescence analysis of U-2 OS cells using LRRFIP2 antibody (NBP3-15516) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/LRRFIP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-15516-img0001.jpg "Immunocytochemistry/Immunofluorescence: LRRFIP2 Antibody [NBP3-15516] - Immunofluorescence analysis of U-2 OS cells using LRRFIP2 antibody (NBP3-15516) at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Simple Western Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Simple_Western_16408.jpg)
![Western Blot Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Western_Blot_11566.jpg)
![Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Immunohistochemistry_11621.jpg)
![Immunohistochemistry Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_9_AF3827_Immunohistochemistry_24134.jpg)
![Immunocytochemistry/ Immunofluorescence Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images/af3827_mouse-integrin-alpha-9-affinity-purified-polyclonal-ab-41202412394961.jpg)
![Immunocytochemistry/ Immunofluorescence Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images/af3827_mouse-integrin-alpha-9-affinity-purified-polyclonal-ab-41202412402515.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")