LRRFIP2 Antibody - BSA Free

Immunohistochemistry-Paraffin: LRRFIP2 Antibody [NBP1-83147] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LRRFIP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LRRFIP2 Antibody - BSA Free (NBP1-83147) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PGFTNDDTASIVSSDRASRGRRESVVSAADYFSRSNRRGSVVSEVDDISIPDLSSLDEKSDKQYAENYTRPSSRNSASATTPLSGNSS
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRRFIP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LRRFIP2 Protein (NBP1-83147PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LRRFIP2 Antibody - BSA Free

• DKFZp434H2035
• FLJ20248
• FLJ22683
• FLJ58304
• HUFI-2
• leucine rich repeat (in FLII) interacting protein 2
• leucine-rich repeat flightless-interacting protein 2
• LRR FLII-interacting protein 2

Background

LRRFIP2 may function as activator of the canonical Wnt signaling pathway, in association with DVL3, upstream of CTNNB1/beta-catenin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRRFIP2