LRRFIP2 Antibody

Images

 
Immunohistochemistry-Paraffin: LRRFIP2 Antibody [NBP1-83147] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRFIP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PGFTNDDTASIVSSDRASRGRRESVVSAADYFSRSNRRGSVVSEVDDISIPDLSSLDEKSDKQYAENYTRPSSRNSASATTPLSGNSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRFIP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRRFIP2 Protein (NBP1-83147PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRFIP2 Antibody

  • DKFZp434H2035
  • FLJ20248
  • FLJ22683
  • FLJ58304
  • HUFI-2
  • leucine rich repeat (in FLII) interacting protein 2
  • leucine-rich repeat flightless-interacting protein 2
  • LRR FLII-interacting protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24672
Species: Hu
Applications: WB
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-56552
Species: Hu
Applications: WB
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-34109
Species: Hu
Applications: IHC, IHC-P
NBP1-83147
Species: Hu
Applications: IHC, IHC-P

Publications for LRRFIP2 Antibody (NBP1-83147) (0)

There are no publications for LRRFIP2 Antibody (NBP1-83147).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRFIP2 Antibody (NBP1-83147) (0)

There are no reviews for LRRFIP2 Antibody (NBP1-83147). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LRRFIP2 Antibody (NBP1-83147) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRFIP2 Products

Bioinformatics Tool for LRRFIP2 Antibody (NBP1-83147)

Discover related pathways, diseases and genes to LRRFIP2 Antibody (NBP1-83147). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRFIP2 Antibody (NBP1-83147)

Discover more about diseases related to LRRFIP2 Antibody (NBP1-83147).
 

Pathways for LRRFIP2 Antibody (NBP1-83147)

View related products by pathway.

PTMs for LRRFIP2 Antibody (NBP1-83147)

Learn more about PTMs related to LRRFIP2 Antibody (NBP1-83147).

Blogs on LRRFIP2

There are no specific blogs for LRRFIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRFIP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRFIP2