Novus Biologicals products are now on bio-techne.com

LRRC47 Antibody

Images

 
Independent Antibodies: Western Blot: LRRC47 Antibody [NBP1-93597] - Analysis using Anti-LRRC47 antibody NBP1-93597 (A) shows similar pattern to independent antibody NBP1-93598 (B).
Immunocytochemistry/ Immunofluorescence: LRRC47 Antibody [NBP1-93597] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & cytosol.
Immunohistochemistry-Paraffin: LRRC47 Antibody [NBP1-93597] - Staining of human cerebral cortex.
Western Blot: LRRC47 Antibody [NBP1-93597] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: LRRC47 Antibody [NBP1-93597] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: LRRC47 Antibody [NBP1-93597] - Staining of human cerebral cortex, colon, kidney and testis using Anti-LRRC47 antibody NBP1-93597 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: LRRC47 Antibody [NBP1-93597] - Staining of human testis.
Immunohistochemistry-Paraffin: LRRC47 Antibody [NBP1-93597] - Staining of human kidney.
Immunohistochemistry-Paraffin: LRRC47 Antibody [NBP1-93597] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

LRRC47 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PGNALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC47
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRC47 Protein (NBP1-93597PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC47 Antibody

  • KIAA1185
  • leucine rich repeat containing 47
  • leucine-rich repeat-containing protein 47

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-24859
Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-92327
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20265
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89725
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00057180-B01P
Species: Hu
Applications: WB
NBP1-87679
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00010312-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, WB

Publications for LRRC47 Antibody (NBP1-93597) (0)

There are no publications for LRRC47 Antibody (NBP1-93597).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC47 Antibody (NBP1-93597) (0)

There are no reviews for LRRC47 Antibody (NBP1-93597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LRRC47 Antibody (NBP1-93597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC47 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC47