LRRC25 Antibody

Images

 
Western Blot: LRRC25 Antibody [NBP1-83476] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: LRRC25 Antibody [NBP1-83476] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC25 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRRC25 Protein (NBP1-83476PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC25 Antibody

  • leucine rich repeat containing 25
  • leucine-rich repeat-containing protein 25
  • MAPAFLJ38116
  • monocyte and plasmacytoid activated molecule
  • Monocyte and plasmacytoid-activated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37458
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB6287
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-31566
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-53210
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PAGE
AF347
Species: Hu
Applications: WB, IHC, Neut
H00054922-B01P
Species: Hu, Mu
Applications: WB, ELISA
AF4904
Species: Hu
Applications: WB
NBP2-56992
Species: Hu
Applications: IHC-P
NBP1-71701
Species: Hu, Mu
Applications: WB
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-83476
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LRRC25 Antibody (NBP1-83476) (0)

There are no publications for LRRC25 Antibody (NBP1-83476).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC25 Antibody (NBP1-83476) (0)

There are no reviews for LRRC25 Antibody (NBP1-83476). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRC25 Antibody (NBP1-83476) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRC25 Products

Bioinformatics Tool for LRRC25 Antibody (NBP1-83476)

Discover related pathways, diseases and genes to LRRC25 Antibody (NBP1-83476). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC25 Antibody (NBP1-83476)

Discover more about diseases related to LRRC25 Antibody (NBP1-83476).
 

Pathways for LRRC25 Antibody (NBP1-83476)

View related products by pathway.

Blogs on LRRC25

There are no specific blogs for LRRC25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC25