LRP2BP Antibody

Images

 
Immunohistochemistry: LRP2BP Antibody [NBP1-84097] - Staining of human cerebellum shows distinct positivity in neuronal filament.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRP2BP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPMIAQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRDETTAKHYYSKACRLNPALADELHSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRP2BP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRP2BP Protein (NBP1-84097PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRP2BP Antibody

  • DKFZp761O0113
  • FLJ44965
  • LRP2 binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
H00002483-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87034
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-39004
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77089
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85361
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-42378
Species: Hu
Applications: WB, IHC

Publications for LRP2BP Antibody (NBP1-84097) (0)

There are no publications for LRP2BP Antibody (NBP1-84097).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRP2BP Antibody (NBP1-84097) (0)

There are no reviews for LRP2BP Antibody (NBP1-84097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LRP2BP Antibody (NBP1-84097) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRP2BP Products

Bioinformatics Tool for LRP2BP Antibody (NBP1-84097)

Discover related pathways, diseases and genes to LRP2BP Antibody (NBP1-84097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRP2BP Antibody (NBP1-84097)

Discover more about diseases related to LRP2BP Antibody (NBP1-84097).
 

Pathways for LRP2BP Antibody (NBP1-84097)

View related products by pathway.

Blogs on LRP2BP

There are no specific blogs for LRP2BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRP2BP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRP2BP