LRCH1 Antibody

Images

 
Western Blot: LRCH1 Antibody [NBP2-87737] - Host: Rabbit. Target Name: LRCH1. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRCH1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human LRCH1. Peptide sequence: LHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
LRCH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRCH1 Antibody

  • CHDC1
  • FLJ41660
  • KIAA1016
  • leucine-rich repeat and calponin homology domain-containing protein 1
  • leucine-rich repeats and calponin homology (CH) domain containing 1
  • neuronal protein 81
  • NP81

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

853-G5/CF
Species: Mu
Applications: BA
NBP1-85616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-15492
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
7584-SF/CF
Species: Hu
Applications: BA
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP3-06185
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-76347
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP1-06542
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NBP2-37607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF1705
Species: Mu
Applications: IHC, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-20154
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for LRCH1 Antibody (NBP2-87737) (0)

There are no publications for LRCH1 Antibody (NBP2-87737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRCH1 Antibody (NBP2-87737) (0)

There are no reviews for LRCH1 Antibody (NBP2-87737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRCH1 Antibody (NBP2-87737) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRCH1 Products

Bioinformatics Tool for LRCH1 Antibody (NBP2-87737)

Discover related pathways, diseases and genes to LRCH1 Antibody (NBP2-87737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRCH1 Antibody (NBP2-87737)

Discover more about diseases related to LRCH1 Antibody (NBP2-87737).
 

Pathways for LRCH1 Antibody (NBP2-87737)

View related products by pathway.

Blogs on LRCH1

There are no specific blogs for LRCH1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRCH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRCH1