LPAR2/LPA2/EDG-4 Recombinant Protein Antigen

Images

 
There are currently no images for LPAR2/LPA2/EDG-4 Protein (NBP1-84904PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LPAR2/LPA2/EDG-4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LPAR2.

Source: E. coli

Amino Acid Sequence: LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LPAR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84904.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LPAR2/LPA2/EDG-4 Recombinant Protein Antigen

  • EDG4
  • EDG-4
  • EDG4FLJ93869
  • endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor4,LPA receptor EDG4
  • G protein-coupled receptor
  • LPA2
  • LPA-2
  • LPA2LPA receptor 2
  • LPAR2
  • lysophosphatidic acid receptor 2
  • lysophosphatidic acid receptor EDG4
  • Lysophosphatidic acid receptor Edg-4

Background

Edg4 is a Lysophospholipid/Lysosphingolipid Receptor activated by phosphatidic acid (PA) and lysophosphatidic acid (LPA). It enhances the transcription of serum response element (SRE) reporter genes. In CD4(+) T cells, Edg4 may be involved in the control of interleukin-2 secretion. Edg4 expression has been documented in leukocytes, pancreas, spleen, thymus, prostate, and testis. Edg4 expression has also been seen in many cancer cell lines, including those of brain, blood, breast, ovary, cervix, colon, skin, and thyroid. ESTs have been isolated from B-cell/lung/testis, blood, brain, embryo, heart/melanocyte/uterus, liver, placenta, prostate, and skin libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-03363
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC,  IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NLS1895
Species: Bt, Ha, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P
MAB7089
Species: Mu
Applications: CyTOF-ready, Flow, IHC
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP3-05161
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-26691
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24762
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
5255-EN
Species: Hu
Applications: EnzAct
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
DVE00
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
236-EG
Species: Hu
Applications: BA

Publications for LPAR2/LPA2/EDG-4 Protein (NBP1-84904PEP) (0)

There are no publications for LPAR2/LPA2/EDG-4 Protein (NBP1-84904PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LPAR2/LPA2/EDG-4 Protein (NBP1-84904PEP) (0)

There are no reviews for LPAR2/LPA2/EDG-4 Protein (NBP1-84904PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LPAR2/LPA2/EDG-4 Protein (NBP1-84904PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LPAR2/LPA2/EDG-4 Products

Research Areas for LPAR2/LPA2/EDG-4 Protein (NBP1-84904PEP)

Find related products by research area.

Blogs on LPAR2/LPA2/EDG-4

There are no specific blogs for LPAR2/LPA2/EDG-4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LPAR2/LPA2/EDG-4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LPAR2