LOXL1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: LOXL1 Antibody [NBP1-82827] - Analysis in human cervix, uterine and liver tissues. Corresponding LOXL1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: LOXL1 Antibody [NBP1-82827] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: LOXL1 Antibody [NBP1-82827] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells.
Immunohistochemistry-Paraffin: LOXL1 Antibody [NBP1-82827] - Staining of human urothelium shows moderate to strong membranous positivity.
Immunohistochemistry-Paraffin: LOXL1 Antibody [NBP1-82827] - Staining of human cervix, uterine shows moderate to strong membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: LOXL1 Antibody [NBP1-82827] - Staining of human seminal vesicle shows moderate to strong membranous positivity in stromal cells.

Product Details

Summary
Product Discontinued
View other related LOXL1 Primary Antibodies
Validated by:
       

Orthogonal Strategies

 

Order Details


    • Catalog Number
      NBP1-82827
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LOXL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QVPDNWREVAVGDSTGMARARTSVSQQRHGGSASSVSASAFASTYRQQPSYPQQFPYPQAPFVSQYENYDPASRTYDQGF
Specificity
Specificity of human LOXL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LOXL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publications using
NBP1-82827 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LOXL1 Antibody

  • EC 1.4.3.13
  • LOLEC 1.4.3
  • LOXLEC 1.4.3.-
  • lysyl oxidase homolog 1
  • lysyl oxidase-like 1
  • Lysyl oxidase-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-32954
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3095
Species: Hu
Applications: WB, IHC
NBP2-32692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
8090-ZN
Species: Hu
NB110-8146
Species: Hu, Po, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-54724
Species: Hu
Applications: WB, IHC, IHC-P
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
7270-IL/CF
Species: Hu
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for LOXL1 Antibody (NBP1-82827)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, IHC-P.


Filter By Application
IHC
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for LOXL1 Antibody (NBP1-82827) (0)

There are no reviews for LOXL1 Antibody (NBP1-82827). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LOXL1 Antibody (NBP1-82827) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for LOXL1 Antibody (NBP1-82827)

Discover related pathways, diseases and genes to LOXL1 Antibody (NBP1-82827). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LOXL1 Antibody (NBP1-82827)

Discover more about diseases related to LOXL1 Antibody (NBP1-82827).
 

Pathways for LOXL1 Antibody (NBP1-82827)

View related products by pathway.

PTMs for LOXL1 Antibody (NBP1-82827)

Learn more about PTMs related to LOXL1 Antibody (NBP1-82827).

Blogs on LOXL1

There are no specific blogs for LOXL1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LOXL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LOXL1