Recombinant Human LNX2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LNX2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 100 of Human LNX2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGTTSDEMVSVEQTSSSSLNPLCFECGQQHWTRENHLYNYQNEVDDDLVCHICLQPLLQPLDTPCGHTFCYKCLRNFLQEKDFCPLDRKRLHFKLCKKSS

Protein/Peptide Type
Partial Recombinant Protein
Gene
LNX2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LNX2 Protein

  • FLJ23932
  • FLJ38000
  • ligand of Numb protein X 2
  • ligand of numb-protein X 2
  • MGC46315
  • Numb-binding protein 2
  • PDZ domain containing ring finger 1
  • PDZ domain-containing RING finger protein 1
  • PDZRN1FLJ12933

Background

LNX2 - ligand of numb-protein X 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58844
Species: Hu
Applications: ICC/IF
NBP1-81441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85144
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-34104
Species: Hu
Applications: IHC, IHC-P
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF1213
Species: Mu
Applications: WB, IHC, Block, ICC
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
AF4937
Species: Hu
Applications: WB, IHC

Publications for LNX2 Partial Recombinant Protein (H00222484-Q01) (0)

There are no publications for LNX2 Partial Recombinant Protein (H00222484-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LNX2 Partial Recombinant Protein (H00222484-Q01) (0)

There are no reviews for LNX2 Partial Recombinant Protein (H00222484-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LNX2 Partial Recombinant Protein (H00222484-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LNX2 Products

Bioinformatics Tool for LNX2 Partial Recombinant Protein (H00222484-Q01)

Discover related pathways, diseases and genes to LNX2 Partial Recombinant Protein (H00222484-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LNX2 Partial Recombinant Protein (H00222484-Q01)

Discover more about diseases related to LNX2 Partial Recombinant Protein (H00222484-Q01).
 

Pathways for LNX2 Partial Recombinant Protein (H00222484-Q01)

View related products by pathway.

Research Areas for LNX2 Partial Recombinant Protein (H00222484-Q01)

Find related products by research area.

Blogs on LNX2

There are no specific blogs for LNX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LNX2 Antibody
NBP1-81069

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LNX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LNX2