LMTK3 Recombinant Protein Antigen

Images

 
There are currently no images for LMTK3 Recombinant Protein Antigen (NBP2-62711PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LMTK3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LMTK3.

Source: E.coli

Amino Acid Sequence: CSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LMTK3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-62711. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LMTK3 Recombinant Protein Antigen

  • AATYK3
  • EC 2.7.11.1
  • lemur tyrosine kinase 3KIAA1883TYKLM3LMR3
  • serine/threonine-protein kinase LMTK3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-16521
Species: Hu, Mu, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-42864
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1016
Species: Hu
Applications: WB, Neut
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF3206
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF641
Species: Mu
Applications: WB, IHC
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1042
Species: Mu
Applications: WB, IHC
NBP2-37289
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF321
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-24519
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
AF2000
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow

Publications for LMTK3 Recombinant Protein Antigen (NBP2-62711PEP) (0)

There are no publications for LMTK3 Recombinant Protein Antigen (NBP2-62711PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMTK3 Recombinant Protein Antigen (NBP2-62711PEP) (0)

There are no reviews for LMTK3 Recombinant Protein Antigen (NBP2-62711PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LMTK3 Recombinant Protein Antigen (NBP2-62711PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional LMTK3 Products

Array NBP2-62711PEP

Bioinformatics Tool for LMTK3 Recombinant Protein Antigen (NBP2-62711PEP)

Discover related pathways, diseases and genes to LMTK3 Recombinant Protein Antigen (NBP2-62711PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMTK3 Recombinant Protein Antigen (NBP2-62711PEP)

Discover more about diseases related to LMTK3 Recombinant Protein Antigen (NBP2-62711PEP).

PTMs for LMTK3 Recombinant Protein Antigen (NBP2-62711PEP)

Learn more about PTMs related to LMTK3 Recombinant Protein Antigen (NBP2-62711PEP).
 

Research Areas for LMTK3 Recombinant Protein Antigen (NBP2-62711PEP)

Find related products by research area.

Blogs on LMTK3

There are no specific blogs for LMTK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LMTK3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LMTK3