LMTK3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

LMTK3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LMTK3.
  
  

  Source: E. coli

  Amino Acid Sequence: CSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: LMTK3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62711.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LMTK3 Recombinant Protein Antigen

• AATYK3
• EC 2.7.11.1
• KIAA1883
• lemur tyrosine kinase 3KIAA1883TYKLM3LMR3
• LMR3
• LMTK3
• PPP1R101
• serine/threonine-protein kinase LMTK3
• TYKLM3

Background

LMTK3, or Lemur Tyrosine Kinase 3, consists of a 1,460 amino acid isoform that is 153,661 kDa, and is considered a membrane protein, though its function is not known. Current research is being conducted on the relationship between LMTK3 and a variety of diseases and disorders, including uterine sarcoma, pancreatitis, thyroid carcinoma, adenocarcinoma, breast cancer, and thyroiditis. LMTK3 has been linked to Paxillin interactions, intracellular calcium signaling, MAPK signaling, Akt signaling, the GPCR pathway, and the Endothelin-1 signaling pathway. The protein interacts with ZBTB16 and PPP1CA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: LMTK3