LMO1 Antibody (4C7)

Images

 
There are currently no images for LMO1 Antibody (H00004004-M06).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LMO1 Antibody (4C7) Summary

Immunogen
LMO1 (NP_002306, 15 a.a. - 156 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ
Specificity
LMO1 (4C7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LMO1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMO1 Antibody (4C7)

  • Cysteine-rich protein TTG-1
  • LIM domain only 1 (rhombotin 1)
  • LMO-1
  • RBTN1MGC116692
  • RHOM1LIM domain only protein 1
  • rhombotin-1
  • TTG1T-cell translocation protein 1

Background

LMO1 enocdes a cysteine-rich, two LIM domain transcriptional regulator. It is mapped to an area of consistent chromosomal translocation in chromosome 11, disrupting it in T-cell leukemia, although more rarely than the related gene, LMO2 is disrupted.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-83978
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP2-43538
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
H00055885-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB7650
Species: Mu
Applications: WB, IHC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
25280002
Species: Hu
Applications: ELISA, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-27188
Species: Hu, Po, Ca, Pm
Applications: WB, Simple Western
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for LMO1 Antibody (H00004004-M06) (0)

There are no publications for LMO1 Antibody (H00004004-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMO1 Antibody (H00004004-M06) (0)

There are no reviews for LMO1 Antibody (H00004004-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMO1 Antibody (H00004004-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMO1 Products

Bioinformatics Tool for LMO1 Antibody (H00004004-M06)

Discover related pathways, diseases and genes to LMO1 Antibody (H00004004-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMO1 Antibody (H00004004-M06)

Discover more about diseases related to LMO1 Antibody (H00004004-M06).
 

Pathways for LMO1 Antibody (H00004004-M06)

View related products by pathway.

PTMs for LMO1 Antibody (H00004004-M06)

Learn more about PTMs related to LMO1 Antibody (H00004004-M06).
 

Research Areas for LMO1 Antibody (H00004004-M06)

Find related products by research area.

Blogs on LMO1

There are no specific blogs for LMO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMO1 Antibody (4C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol LMO1
Entrez
OMIM
Uniprot