LMO1 Antibody (1A9) - Azide and BSA Free

Western Blot: LMO1 Antibody (1A9) [H00004004-M02] - Detection against Immunogen (35.64 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1A9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LMO1 Antibody (1A9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: LMO1 (NP_002306, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAA
• Specificity: LMO1 - LIM domain only 1 (rhombotin 1)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LMO1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMO1 Antibody (1A9) - Azide and BSA Free

• Cysteine-rich protein TTG-1
• LIM domain only 1 (rhombotin 1)
• LMO-1
• RBTN1MGC116692
• RHOM1LIM domain only protein 1
• rhombotin-1
• TTG1T-cell translocation protein 1

Background

LMO1 enocdes a cysteine-rich, two LIM domain transcriptional regulator. It is mapped to an area of consistent chromosomal translocation in chromosome 11, disrupting it in T-cell leukemia, although more rarely than the related gene, LMO2 is disrupted.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LMO1
• Entrez:
  • 4004(Human)
• OMIM:
  • 186921(Human)
• Uniprot:
  • NP_002306(Human)