LMAN2L Antibody

Images

 
Western Blot: LMAN2L Antibody [NBP1-84152] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: LMAN2L Antibody [NBP1-84152] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Western Blot: LMAN2L Antibody [NBP1-84152] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LMAN2L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMAN2L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LMAN2L Protein (NBP1-84152PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LMAN2L Antibody

  • DKFZp564L2423
  • Lectin mannose-binding 2-like
  • lectin, mannose-binding 2-like
  • LMAN2-like protein
  • MGC11139
  • VIPLVIP36-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-17153
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-58498
Species: Hu
Applications: ICC/IF
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87132
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-47542
Species: Hu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-495
Species: Hu
Applications: WB
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-48308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
AF2556
Species: Mu
Applications: WB, IHC
NBP2-45514
Species: Hu
Applications: WB, IHC

Publications for LMAN2L Antibody (NBP1-84152) (0)

There are no publications for LMAN2L Antibody (NBP1-84152).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMAN2L Antibody (NBP1-84152) (0)

There are no reviews for LMAN2L Antibody (NBP1-84152). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMAN2L Antibody (NBP1-84152) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMAN2L Products

Bioinformatics Tool for LMAN2L Antibody (NBP1-84152)

Discover related pathways, diseases and genes to LMAN2L Antibody (NBP1-84152). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMAN2L Antibody (NBP1-84152)

Discover more about diseases related to LMAN2L Antibody (NBP1-84152).
 

Pathways for LMAN2L Antibody (NBP1-84152)

View related products by pathway.

PTMs for LMAN2L Antibody (NBP1-84152)

Learn more about PTMs related to LMAN2L Antibody (NBP1-84152).

Blogs on LMAN2L

There are no specific blogs for LMAN2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMAN2L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMAN2L