LLC1 Antibody

Images

 
Immunohistochemistry-Paraffin: C20orf85 Antibody [NBP2-49451] - Staining of human placenta shows low expression as expected.
Immunohistochemistry-Paraffin: C20orf85 Antibody [NBP2-49451] - Staining of human fallopian tube shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: C20orf85 Antibody [NBP2-49451] - Staining in human fallopian tube and placenta tissues using anti-C20orf85 antibody. Corresponding C20orf85 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

LLC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FRIRPVTPVEKYIKVFPSPPVPQTTQGFIGWRSAVPGLNKCLELDDAIRSCKGAFARELCWPKQGVH
Specificity
Specificity of human C20orf85 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C20ORF85
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LLC1 Antibody

  • bA196N14.1
  • chromosome 20 open reading frame 85
  • hypothetical protein LOC128602
  • LLC1
  • low in lung cancer 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1414
Species: Hu
Applications: WB, PEP-ELISA
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP1-87679
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13245
Species: Hu
Applications: IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-86079
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
6507-IL/CF
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for LLC1 Antibody (NBP2-49451) (0)

There are no publications for LLC1 Antibody (NBP2-49451).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LLC1 Antibody (NBP2-49451) (0)

There are no reviews for LLC1 Antibody (NBP2-49451). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LLC1 Antibody (NBP2-49451) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LLC1 Products

Bioinformatics Tool for LLC1 Antibody (NBP2-49451)

Discover related pathways, diseases and genes to LLC1 Antibody (NBP2-49451). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LLC1 Antibody (NBP2-49451)

Discover more about diseases related to LLC1 Antibody (NBP2-49451).
 

Pathways for LLC1 Antibody (NBP2-49451)

View related products by pathway.

PTMs for LLC1 Antibody (NBP2-49451)

Learn more about PTMs related to LLC1 Antibody (NBP2-49451).

Blogs on LLC1

There are no specific blogs for LLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LLC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C20ORF85