LIMS2 Antibody - BSA Free

Western Blot: LIMS2 Antibody [NBP2-85209] - WB Suggested Anti-LIMS2 Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole Cell

Western Blot: LIMS2 Antibody [NBP2-85209] - Host: Rabbit. Target: LIMS2. Positive control (+): Human Fetal Heart (HE). Negative control (-): Human Brain (BR). Antibody concentration: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LIMS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LIMS2 Antibody - BSA Free (NBP2-85209) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LIMS2. Peptide sequence: DVELADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LIMS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LIMS2 Antibody - BSA Free

• FLJ10044
• ILK-binding protein
• LIM and senescent cell antigen-like domains 2
• LIM and senescent cell antigen-like-containing domain protein 2
• LIM-like protein 2
• Particularly interesting new Cys-His protein 2
• PINCH2
• PINCH-2

Background

LIMS2 is a focal adhesion protein that associates with integrin-linked kinase (ILK; MIM 602366), a multidomain protein that mediates multiple protein-protein interactions at adhesion sites between cells and the extracellular matrix (ECM).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LIMS2