![Western Blot: LIMCH1 Antibody [NBP2-39006] - Analysis in human cell line HeLa and human cell line PC-3.](http://images.novusbio.com/fullsize/LIMCH1-Antibody-Western-Blot-NBP2-39006-img0008.jpg "Western Blot: LIMCH1 Antibody [NBP2-39006] - Analysis in human cell line HeLa and human cell line PC-3.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit LIMCH1 Antibody - BSA Free (NBP2-39006) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLRQQSLPPPKFTATVETTIARASV |
| Predicted Species | Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LIMCH1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LIMCH1 Antibody (NBP2-39006)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: LIMCH1 Antibody [NBP2-39006] - Staining of human cell line HeLa shows localization to actin filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/LIMCH1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39006-img0003.jpg "Immunocytochemistry/Immunofluorescence: LIMCH1 Antibody [NBP2-39006] - Staining of human cell line HeLa shows localization to actin filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: LIMCH1 Antibody [NBP2-39006] - Staining of human tonsil shows no positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/LIMCH1-Antibody-Immunohistochemistry-Paraffin-NBP2-39006-img0007.jpg "Immunohistochemistry-Paraffin: LIMCH1 Antibody [NBP2-39006] - Staining of human tonsil shows no positivity in germinal center cells as expected.")
![Immunohistochemistry-Paraffin: LIMCH1 Antibody [NBP2-39006] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/LIMCH1-Antibody-Immunohistochemistry-Paraffin-NBP2-39006-img0004.jpg "Immunohistochemistry-Paraffin: LIMCH1 Antibody [NBP2-39006] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: LIMCH1 Antibody [NBP2-39006] - Staining of human lung shows moderate cytoplasmic positivity in pneumocytes.](http://images.novusbio.com/fullsize/LIMCH1-Antibody-Immunohistochemistry-Paraffin-NBP2-39006-img0005.jpg "Immunohistochemistry-Paraffin: LIMCH1 Antibody [NBP2-39006] - Staining of human lung shows moderate cytoplasmic positivity in pneumocytes.")
![Immunohistochemistry-Paraffin: LIMCH1 Antibody [NBP2-39006] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/LIMCH1-Antibody-Immunohistochemistry-Paraffin-NBP2-39006-img0006.jpg "Immunohistochemistry-Paraffin: LIMCH1 Antibody [NBP2-39006] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.")
![Western Blot Afadin/AF-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Afadin_AF7829_Western_Blot_12834.jpg)
![Immunohistochemistry Afadin/AF-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Afadin_AF7829_Immunohistochemistry_12854.jpg)
![Immunocytochemistry Afadin/AF-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Afadin_AF7829_Immunocytochemistry_14433.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")