LIMCH1 Antibody

Images

 
Immunohistochemistry-Paraffin: LIMCH1 Antibody [NBP1-85056] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIMCH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HTEEVKLIVTCNMRAQESEPVEGGLRKVPDLHKDDLAQQRIQGSLAPHREPPSFITLSNITEADLETWERLKVSEKARDGDVQHICASEPSPEIKAETAIRDDFANRKARASKKASSPRQKFVHFGPVTELDQQKW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIMCH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LIMCH1 Protein (NBP1-85056PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIMCH1 Antibody

  • DKFZp434I0312
  • DKFZP686A01247
  • DKFZp686B2470
  • DKFZp686G18243
  • DKFZp686G2094
  • DKFZp781C1754
  • DKFZp781I1455
  • KIAA1102
  • LIM and calponin homology domains 1
  • LIM and calponin homology domains-containing protein 1
  • LIMCH1A
  • LMO7B
  • MGC72127

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46403
Species: Hu
Applications: IHC
NBP1-83915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7829
Species: Hu
Applications: WB, IHC, ICC
NBP2-45876
Species: Hu
Applications: WB, IHC
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-27417
Species: Hu, Mu, Rt
Applications: WB
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-39097
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82073
Species: Hu
Applications: IHC, IHC-P
NBP2-03135
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45458
Species: Hu
Applications: WB, IHC

Publications for LIMCH1 Antibody (NBP1-85056) (0)

There are no publications for LIMCH1 Antibody (NBP1-85056).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIMCH1 Antibody (NBP1-85056) (0)

There are no reviews for LIMCH1 Antibody (NBP1-85056). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LIMCH1 Antibody (NBP1-85056) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIMCH1 Products

Bioinformatics Tool for LIMCH1 Antibody (NBP1-85056)

Discover related pathways, diseases and genes to LIMCH1 Antibody (NBP1-85056). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIMCH1 Antibody (NBP1-85056)

Discover more about diseases related to LIMCH1 Antibody (NBP1-85056).
 

Pathways for LIMCH1 Antibody (NBP1-85056)

View related products by pathway.

Blogs on LIMCH1

There are no specific blogs for LIMCH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIMCH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIMCH1