LIM kinase 2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

LIM kinase 2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIMK2.
  
  

  Source: E. coli

  Amino Acid Sequence: VEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSSYSQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: LIMK2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85783.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LIM kinase 2 Recombinant Protein Antigen

• EC 2.7.11.1
• LIM domain kinase 2
• LIM kinase 2
• LIMK2
• LIMK-2

Background

LIM-kinase 2 (LIMK2), a 75-kDa member of the LIM kinase family, is responsible for regulating actin polymerization via phosphorylation and inactivation of the actin depolymerizing factors ADF/cofilin (1). LIMK2 protein is found in the cytoplasm during interphase, redistributed to the mitotic spindle and then to the spindle midzone during anaphase to telophase (2). It has been shown that ROCK, a downstream protein kinase of Rho, activates LIMK2 by directly phosphorylates threonine 505 residue. Since activity of LIMK2 is cell cycle dependant, LIMK2 activity is markedly increased when HeLa cells are synchronized at mitosis with nocodazole treatment (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: LIMK2