Recombinant Human LIM domain only 3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human LIM domain only 3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-145 of Human LMO3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
LMO3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
41.58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LIM domain only 3 Protein

  • DAT1
  • LIM domain only 3 (rhombotin-like 2)
  • LMO-3
  • neuronal specific transcription factor DAT1
  • Neuronal-specific transcription factor DAT1
  • RBTN3
  • RBTNL2MGC26081
  • Rhom-3
  • RHOM3LIM domain only protein 3
  • rhombotin-3
  • rhombotin-like 2

Background

LMO3( AAH26311, 1 a.a. - 146 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004004-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-43538
Species: Hu
Applications: WB, IHC, IHC-P
NB110-78626
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, PEP-ELISA
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-13350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61435
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB6618
Species: Hu, Mu
Applications: WB
AF2567
Species: Mu
Applications: WB, IHC
NBP2-68851
Species: Hu
Applications: ICC/IF
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NBP1-84969
Species: Hu
Applications: WB, IHC, IHC-P
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-83430
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6529
Species: Hu
Applications: WB, Simple Western

Publications for LIM domain only 3 Recombinant Protein (H00055885-P01) (0)

There are no publications for LIM domain only 3 Recombinant Protein (H00055885-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIM domain only 3 Recombinant Protein (H00055885-P01) (0)

There are no reviews for LIM domain only 3 Recombinant Protein (H00055885-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIM domain only 3 Recombinant Protein (H00055885-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for LIM domain only 3 Recombinant Protein (H00055885-P01)

Discover related pathways, diseases and genes to LIM domain only 3 Recombinant Protein (H00055885-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIM domain only 3 Recombinant Protein (H00055885-P01)

Discover more about diseases related to LIM domain only 3 Recombinant Protein (H00055885-P01).
 

Pathways for LIM domain only 3 Recombinant Protein (H00055885-P01)

View related products by pathway.

PTMs for LIM domain only 3 Recombinant Protein (H00055885-P01)

Learn more about PTMs related to LIM domain only 3 Recombinant Protein (H00055885-P01).

Blogs on LIM domain only 3

There are no specific blogs for LIM domain only 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Slit2 Antibody
NBP2-20398

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LIM domain only 3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LMO3