LIM domain only 3 Antibody (2H2) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: LIM domain only 3 Antibody (2H2) [H00055885-M03] - Analysis of monoclonal antibody to LMO3 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: LIM domain only 3 Antibody (2H2) [H00055885-M03] - Detection limit for recombinant GST tagged LMO3 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2H2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LIM domain only 3 Antibody (2H2) - Azide and BSA Free Summary

• Immunogen: LMO3 (NP_061110, 91 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR
• Specificity: LMO3 - LIM domain only 3 (rhombotin-like 2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LMO3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LIM domain only 3 Antibody (2H2) - Azide and BSA Free

• DAT1
• LIM domain only 3 (rhombotin-like 2)
• LMO-3
• neuronal specific transcription factor DAT1
• Neuronal-specific transcription factor DAT1
• RBTN3
• RBTNL2MGC26081
• Rhom-3
• RHOM3LIM domain only protein 3
• rhombotin-3
• rhombotin-like 2

Background

LMO3( AAH26311, 1 a.a. - 146 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LMO3
• Entrez:
  • 55885(Human)
• OMIM:
  • 180386(Human)
• Uniprot:
  • NP_061110(Human)