Recombinant Human LHFP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LHFP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-200 of Human LHFP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASSLTCTGVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYPLGWDSEEVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
LHFP

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LHFP Protein

  • lipoma HMGIC fusion partner
  • MGC22429

Background

This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. This gene is fused to a high-mobility group gene in a translocation-associated lipoma. Mutations in another LHFP-like gene result in deafness in humans and mice. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
594-ML/CF
Species: Mu
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
H00010866-T01
Species: Hu
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB2476
Species: Hu
Applications: WB, IHC
AF4036
Species: Hu
Applications: WB, Simple Western
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-45631
Species: Hu, Mk
Applications: WB, IHC, IF
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5165
Species: Hu, Mu
Applications: WB
H00010186-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for LHFP Recombinant Protein (H00010186-P01) (0)

There are no publications for LHFP Recombinant Protein (H00010186-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHFP Recombinant Protein (H00010186-P01) (0)

There are no reviews for LHFP Recombinant Protein (H00010186-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LHFP Recombinant Protein (H00010186-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LHFP Products

Bioinformatics Tool for LHFP Recombinant Protein (H00010186-P01)

Discover related pathways, diseases and genes to LHFP Recombinant Protein (H00010186-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHFP Recombinant Protein (H00010186-P01)

Discover more about diseases related to LHFP Recombinant Protein (H00010186-P01).
 

Pathways for LHFP Recombinant Protein (H00010186-P01)

View related products by pathway.

PTMs for LHFP Recombinant Protein (H00010186-P01)

Learn more about PTMs related to LHFP Recombinant Protein (H00010186-P01).

Blogs on LHFP

There are no specific blogs for LHFP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
LHFP Antibody
NBP2-31735

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LHFP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LHFP