We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

LDB3 Recombinant Protein Antigen

Images

 
There are currently no images for LDB3 Protein (NBP2-14190PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LDB3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LDB3.

Source: E. coli

Amino Acid Sequence: PIGLYSAETLREMAQMYQMSLRGKASGVGLPGGSLPIKDLAVDSASPVYQAVIKSQNKPEDEADEWARRSSNLQS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LDB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14190.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LDB3 Recombinant Protein Antigen

  • CMD1C
  • CYPHER
  • KIAA01613
  • KIAA0613FLJ35865
  • LDB3Z1
  • LDB3Z4
  • LIM domain binding 3
  • LIM domain-binding protein 3
  • ORACLE
  • PDLIM6
  • PDZ and LIM domain 6
  • Protein cypher
  • ZASPLVNC3
  • Z-band alternatively spliced PDZ-motif protein

Background

LDB3 encodes a PDZ domain-containing protein. PDZ motifs are modular protein-protein interaction domains consisting of 80-120 amino acid residues. PDZ domain-containing proteins interact with each other in cytoskeletal assembly or with other proteins involved in targeting and clustering of membrane proteins. The protein encoded by this gene interacts with alpha-actinin-2 through its N-terminal PDZ domain and with protein kinase C via its C-terminal LIM domains. The LIM domain is a cysteine-rich motif defined by 50-60 amino acids containing two zinc-binding modules. This protein also interacts with all three members of the myozenin family. Mutations in this gene have been associated with myofibrillar myopathy and dilated cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been identified; all isoforms have N-terminal PDZ domains while only longer isoforms (1 and 2) have C-terminal LIM domains. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1266
Applications: CyTOF-ready, IP, ICFlow, WB
NBP3-44982
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85439
Species: Hu
Applications: IHC,  IHC-P
NBP1-85544
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-88071
Species: Hu
Applications: IHC,  IHC-P
NBP1-84443
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80833
Species: Hu, Rt
Applications: ICC/IF,  IHC-P, WB
DPI00
Applications: ELISA
DCC270
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-2519
Species: Hu, Mu
Applications: ICC/IF, WB
NB100-74451
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB

Publications for LDB3 Protein (NBP2-14190PEP) (0)

There are no publications for LDB3 Protein (NBP2-14190PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LDB3 Protein (NBP2-14190PEP) (0)

There are no reviews for LDB3 Protein (NBP2-14190PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LDB3 Protein (NBP2-14190PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LDB3 Products

Array NBP2-14190PEP

Blogs on LDB3

There are no specific blogs for LDB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LDB3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LDB3