LATS2 Recombinant Protein Antigen

Images

 
There are currently no images for LATS2 Recombinant Protein Antigen (NBP2-14184PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LATS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LATS2.

Source: E. coli

Amino Acid Sequence: HLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LATS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14184.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LATS2 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ13161
  • Kinase phosphorylated during mitosis protein
  • KPM
  • Large tumor suppressor homolog 2
  • LATS (large tumor suppressor, Drosophila) homolog 2
  • LATS, large tumor suppressor, homolog 2 (Drosophila)
  • serine/threonine kinase KPM
  • Serine/threonine-protein kinase kpm
  • serine/threonine-protein kinase LATS2
  • Warts-like kinase

Background

LATS2 encodes a serine/threonine protein kinase belonging to the LATS tumor suppressor family. The protein localizes to centrosomes during interphase, and early and late metaphase. It interacts with the centrosomal proteins aurora-A and ajuba and is required for accumulation of gamma-tubulin and spindle formation at the onset of mitosis. It also interacts with a negative regulator of p53 and may function in a positive feedback loop with p53 that responds to cytoskeleton damage. Additionally, it can function as a co-repressor of androgen-responsive gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-197
Species: Hu, Mu
Applications: IP, WB
NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NBP1-81763
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-48017
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00060485-M02
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-87833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-82865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00011329-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
MAB7940
Species: Hu
Applications: IHC, WB
NB110-58359
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, PLA, Simple Western, WB
NBP2-02715
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-92435
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
352-MS
Species: Hu
Applications: BA
NBP2-14184PEP
Species: Hu
Applications: AC

Publications for LATS2 Recombinant Protein Antigen (NBP2-14184PEP) (0)

There are no publications for LATS2 Recombinant Protein Antigen (NBP2-14184PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LATS2 Recombinant Protein Antigen (NBP2-14184PEP) (0)

There are no reviews for LATS2 Recombinant Protein Antigen (NBP2-14184PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LATS2 Recombinant Protein Antigen (NBP2-14184PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LATS2 Products

Research Areas for LATS2 Recombinant Protein Antigen (NBP2-14184PEP)

Find related products by research area.

Blogs on LATS2

There are no specific blogs for LATS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LATS2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LATS2