Recombinant Human LATS1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human LATS1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 521-620 of Human LATS1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
LATS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LATS1 GST (N-Term) Protein

  • EC 2.7.11
  • h-warts
  • Large tumor suppressor homolog 1
  • LATS (large tumor suppressor, Drosophila) homolog 1
  • LATS, large tumor suppressor, homolog 1 (Drosophila)
  • serine/threonine-protein kinase LATS1
  • WARTS protein kinase
  • WARTSEC 2.7.11.1
  • wts

Background

LATS1 - LATS, large tumor suppressor, homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP1-81763
Species: Hu
Applications: IHC, IHC-P, WB
H00060485-M02
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB7940
Species: Hu
Applications: IHC, WB
NBP3-03913
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-48017
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-82865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
352-MS/CF
Species: Hu
Applications: BA, BA
NBP1-87833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-61873
Species: Hu
Applications: ELISA, Flow, WB
H00011329-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-92435
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02715
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB110-58359
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, PLA, Simple Western, WB
MAB5018
Species: Hu
Applications: IP, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB

Publications for LATS1 Partial Recombinant Protein (H00009113-Q01) (0)

There are no publications for LATS1 Partial Recombinant Protein (H00009113-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LATS1 Partial Recombinant Protein (H00009113-Q01) (0)

There are no reviews for LATS1 Partial Recombinant Protein (H00009113-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LATS1 Partial Recombinant Protein (H00009113-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LATS1 Products

Bioinformatics Tool for LATS1 Partial Recombinant Protein (H00009113-Q01)

Discover related pathways, diseases and genes to LATS1 Partial Recombinant Protein (H00009113-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LATS1 Partial Recombinant Protein (H00009113-Q01)

Discover more about diseases related to LATS1 Partial Recombinant Protein (H00009113-Q01).
 

Pathways for LATS1 Partial Recombinant Protein (H00009113-Q01)

View related products by pathway.

PTMs for LATS1 Partial Recombinant Protein (H00009113-Q01)

Learn more about PTMs related to LATS1 Partial Recombinant Protein (H00009113-Q01).
 

Research Areas for LATS1 Partial Recombinant Protein (H00009113-Q01)

Find related products by research area.

Blogs on LATS1.

TAZ Antibody: The Devil is in the Details
WW domain-containing transcription regulator protein 1 also known as WWTR1 and TAZ, is a 44KDa protein that acts as a downstream regulatory target in the Hippo signaling pathway. This protein undergoes post-translational modification and becomes phosp...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LATS1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LATS1