Lass5 Antibody

Product Discontinued

Lass5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GPLSLLWGWLWSERFWLPENVSWADLEGPADGYGY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CERS5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Lass5 Antibody

• CerS5
• FLJ25304
• LAG1 homolog, ceramide synthase 5
• LAG1 longevity assurance homolog 5 (S. cerevisiae)
• LAG1 longevity assurance homolog 5
• MGC45411
• Trh4

Background

Lass5 may be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed incells is involved in the production of sphingolipids containingmainlyone fatty acid donnor (N-linked palmitoyl-(C16) ceramide) in a fumonisin B1-in

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CERS5