LASP1 Antibody [DyLight 550]

Product Discontinued

LASP1 Antibody [DyLight 550] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 130-205 of human LASP1 (NP_006139.1).
  
  Sequence:
  RMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LASP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for LASP1 Antibody [DyLight 550]

• LASP-1
• LIM and SH3 domain protein 1
• LIM and SH3 protein 1
• Metastatic lymph node gene 50 protein
• MLN 50
• MLN50Lasp-1

Background

LASP1 functions as an actin-binding protein and possibly in cytoskeletal organization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LASP1