LARP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LARP2 Antibody [NBP1-84184] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: LARP2 Antibody [NBP1-84184] - Staining of human testis shows strong cytoplasmic positivity in seminiferous tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LARP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KHKWVPLHLDVVRSESQERPGSRNSSRCQPEANKPTHNNRRNDTRSWKRDREKRDDQDDVSSVRSEGGNIRGSF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LARP1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LARP2 Protein (NBP1-84184PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LARP2 Antibody

  • DKFZp434K245
  • DKFZp686E0316
  • DKFZp686L13217
  • FLJ10378
  • La ribonucleoprotein domain family member 1B
  • La ribonucleoprotein domain family member 2
  • La ribonucleoprotein domain family, member 1B
  • La ribonucleoprotein domain family, member 2
  • la-related protein 1B
  • La-related protein 2
  • LARP2
  • MGC117277
  • MGC75174

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for LARP2 Antibody (NBP1-84184) (0)

There are no publications for LARP2 Antibody (NBP1-84184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LARP2 Antibody (NBP1-84184) (0)

There are no reviews for LARP2 Antibody (NBP1-84184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LARP2 Antibody (NBP1-84184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LARP2 Products

LARP2 NBP1-84184

Bioinformatics Tool for LARP2 Antibody (NBP1-84184)

Discover related pathways, diseases and genes to LARP2 Antibody (NBP1-84184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LARP2

There are no specific blogs for LARP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LARP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LARP1B