LAPTM5 Antibody

Images

 
Immunohistochemistry-Paraffin: LAPTM5 Antibody [NBP2-14183] Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LAPTM5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAPTM5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LAPTM5 Protein (NBP2-14183PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAPTM5 Antibody

  • CD40-ligand-activated specific transcripts
  • CLAST6
  • FLJ61683
  • FLJ97251
  • human retinoic acid-inducible E3 protein
  • KIAA0085
  • lysosomal associated multispanning membrane protein 5
  • lysosomal multispanning membrane protein 5
  • lysosomal protein transmembrane 5
  • Lysosomal-associated multitransmembrane protein 5
  • lysosomal-associated transmembrane protein 5
  • MGC125860
  • MGC125861
  • Retinoic acid-inducible E3 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-59416
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81645
Species: Hu
Applications: IHC, IHC-P
NB110-82375
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7157
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40686
Species: Hu, Po, Bv, GP, Pm, RM, Sh
Applications: WB, ELISA, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-CS
NBP2-14183
Species: Hu
Applications: IHC, IHC-P

Publications for LAPTM5 Antibody (NBP2-14183) (0)

There are no publications for LAPTM5 Antibody (NBP2-14183).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAPTM5 Antibody (NBP2-14183) (0)

There are no reviews for LAPTM5 Antibody (NBP2-14183). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LAPTM5 Antibody (NBP2-14183) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LAPTM5 Products

Bioinformatics Tool for LAPTM5 Antibody (NBP2-14183)

Discover related pathways, diseases and genes to LAPTM5 Antibody (NBP2-14183). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAPTM5 Antibody (NBP2-14183)

Discover more about diseases related to LAPTM5 Antibody (NBP2-14183).
 

Pathways for LAPTM5 Antibody (NBP2-14183)

View related products by pathway.

PTMs for LAPTM5 Antibody (NBP2-14183)

Learn more about PTMs related to LAPTM5 Antibody (NBP2-14183).

Blogs on LAPTM5

There are no specific blogs for LAPTM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAPTM5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAPTM5