![Immunohistochemistry-Paraffin: LAPTM5 Antibody [NBP2-14183] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/LAPTM5-Antibody-Immunohistochemistry-Paraffin-NBP2-14183-img0005.jpg "Immunohistochemistry-Paraffin: LAPTM5 Antibody [NBP2-14183] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit LAPTM5 Antibody - BSA Free (NBP2-14183) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LAPTM5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LAPTM5 Antibody (NBP2-14183)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LAPTM5 |
![Immunohistochemistry-Paraffin: LAPTM5 Antibody [NBP2-14183] Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.](http://images.novusbio.com/fullsize/LAPTM5-Antibody-Immunohistochemistry-Paraffin-NBP2-14183-img0001.jpg "Immunohistochemistry-Paraffin: LAPTM5 Antibody [NBP2-14183] Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.")
![Immunohistochemistry-Paraffin: LAPTM5 Antibody [NBP2-14183] - Staining of human lymph node shows strong granular cytoplasmic positivity in subset of non-germinal center cells.](http://images.novusbio.com/fullsize/LAPTM5-Antibody-Immunohistochemistry-Paraffin-NBP2-14183-img0003.jpg "Immunohistochemistry-Paraffin: LAPTM5 Antibody [NBP2-14183] - Staining of human lymph node shows strong granular cytoplasmic positivity in subset of non-germinal center cells.")
![Immunohistochemistry-Paraffin: LAPTM5 Antibody [NBP2-14183] - Staining of human lung shows weak granular cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/LAPTM5-Antibody-Immunohistochemistry-Paraffin-NBP2-14183-img0004.jpg "Immunohistochemistry-Paraffin: LAPTM5 Antibody [NBP2-14183] - Staining of human lung shows weak granular cytoplasmic positivity in macrophages.")
![Western Blot NEDD4 Antibody (683211) [Unconjugated]](https://images.novusbio.com/images2/NEDD4_MAB6218_Western_Blot_10412.jpg)
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
![Western Blot DTX1/DTX4 Antibody (730612) [Unconjugated]](https://images.novusbio.com/images2/DTX1_MAB7157_Western_Blot_11585.jpg)
![Immunocytochemistry DTX1/DTX4 Antibody (730612) [Unconjugated]](https://images.novusbio.com/images2/DTX1_MAB7157_Immunocytochemistry_11667.jpg)
![Intracellular Staining by Flow Cytometry DTX1/DTX4 Antibody (730612) [Unconjugated]](https://images.novusbio.com/images2/DTX1_MAB7157_Flow_Cytometry_12147.jpg)
![N/A CD163 [HRP]](https://images.novusbio.com/images2/CD163_DC1630_ELISA_43.jpg)
![N/A CD163 [HRP]](https://images.novusbio.com/images2/DATA_CD163_DC1630_ELISA_598.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")