Laminin beta 3 Antibody - BSA Free

Western Blot: Laminin beta 3 Antibody [NBP3-35175] - Western blot analysis of lysates from HeLa cells, using Laminin beta 3 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Laminin beta 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Laminin beta 3 Antibody - BSA Free (NBP3-35175) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 762-1004 of human Laminin beta 3 (NP_000219.2).
  
  Sequence:
  QQACSRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQYGEWQMKCCKCDSRQPHNYYSHRVENVASSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVMMEFQGPMPAGMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRPNARLNGGKVQLNLMDLVSGIPATQSQKIQEVGEITNLRVNFTRLAPVPQR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LAMB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:100 - 1:500
• Theoretical MW: 130 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Laminin beta 3 Antibody - BSA Free

• BM600-125kDa
• Epiligrin subunit bata
• FLJ99565
• Kalinin B1 chain
• Kalinin subunit beta
• kalinin-140kDa
• LAM5
• Laminin 5
• Laminin B1k chain
• laminin S B3 chain
• laminin subunit beta-3
• laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD))
• laminin, beta 3
• Laminin-5 subunit beta
• LAMNB1
• Nicein subunit beta
• nicein-125kDa

Background

The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LAMB3