Lamin B1 Antibody (5H8V8) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Lamin B1 (P20700). DGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTI |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
LMNB1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:100 - 1:500
- Immunohistochemistry-Paraffin 1:100 - 1:500
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Lamin B1 Antibody (5H8V8)
Background
Nuclear lamins form a network of intermediate-type filaments at the nucleoplasmic site of the nuclear membrane.Two main subtypes of nuclear lamins can be distinguished, i.e. A-type lamins and B-type lamins. The A-type lamins comprise a set of three proteins arising from the same gene by alternative splicing, i.e. lamin A, lamin C and lamin Adel 10, while the B-type lamins include two proteins arising from two distinct genes, i.e. lamin B1 and lamin B2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Publications for Lamin B1 Antibody (NBP3-15393) (0)
There are no publications for Lamin B1 Antibody (NBP3-15393).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lamin B1 Antibody (NBP3-15393) (0)
There are no reviews for Lamin B1 Antibody (NBP3-15393).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Lamin B1 Antibody (NBP3-15393). (Showing 1 - 1 of 1 FAQ).
-
I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?
- We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.
Secondary Antibodies
| |
Isotype Controls
|
Additional Lamin B1 Products
Research Areas for Lamin B1 Antibody (NBP3-15393)
Find related products by research area.
|
Blogs on Lamin B1