Lactoferrin Recombinant Protein Antigen

Images

 
There are currently no images for Lactoferrin Protein (NBP2-38885PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Lactoferrin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LTF.

Source: E. coli

Amino Acid Sequence: PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LTF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38885.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lactoferrin Recombinant Protein Antigen

  • EC 3.4.21
  • EC 3.4.21.-
  • GIG12
  • growth-inhibiting protein 12
  • HEL110
  • HLF2
  • Kaliocin-1
  • Lactoferricin
  • Lactoferrin
  • Lactoferroxin
  • Lactotransferrin
  • LF
  • LTF
  • neutrophil lactoferrin
  • Talalactoferrin

Background

Lactoferrin is an iron binding glycoprotein with an approximate molecular weight of 80 kDa. The protein has two iron binding domains each housing one Fe3+ and the synergistic CO32- ion. The crystal structure form of human lactoferrin at 2.2A resolution exhibits 5330 protein atoms, 2Fe2+, 2CO32- and 98 carbohydrate atoms. Lactoferrin is absorbed from intestine by apical side of the membrane and localized to the nuclei. Intravenous infusion of lactoferrin is protective against lethal doses of E coli and induce bacterimia by a mechanism that downregulates neutrophil TNF alfa secretion. Recombinant human lactoferrin (rhLF), expressed and extracted from rice seed, is being evaluated for use as a dietary supplement to treat iron deficiency and/or iron deficiency induced anemia. Lactoferrin has been shown to have a role in the immune system and in early development of the embryo. A specific receptor for lactoferrin binding has been implicated in the human fetal intestine. Early embryonic localisation of lactoferrin by IHC has suggested its presence in various tissues including intestinal epitheliuem, kiney, and various regions of the brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2905
Species: Hu
Applications: ELISA, ICC, WB
NB120-10109
Species: Hu
Applications: CyTOF-ready, IHC,  IHC-P, S-ELISA, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
2914-HT
Species: Hu
Applications: BA
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
M6000B
Species: Mu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-28872
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
NBP2-38885PEP
Species: Hu
Applications: AC

Publications for Lactoferrin Protein (NBP2-38885PEP) (0)

There are no publications for Lactoferrin Protein (NBP2-38885PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lactoferrin Protein (NBP2-38885PEP) (0)

There are no reviews for Lactoferrin Protein (NBP2-38885PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lactoferrin Protein (NBP2-38885PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lactoferrin Products

Research Areas for Lactoferrin Protein (NBP2-38885PEP)

Find related products by research area.

Blogs on Lactoferrin.

Cyanine (Cy)
Cyanine dyes are members of the polymethine synthetic dye family historically used to increase photographic emulsion sensitivity. Cyanine dyes have versatile applications and are commonly used as fluorescent labels for proteins, nucleic acids, and sma...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lactoferrin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LTF