Lactate Dehydrogenase C Antibody (2C8) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: Lactate Dehydrogenase C Antibody (2C8) [H00003948-M01] - Analysis of monoclonal antibody to LDHC on HeLa cell . Antibody concentration 10 ug/ml.

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clone: 2C8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Lactate Dehydrogenase C Antibody (2C8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: LDHC (NP_002292.1, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIG
• Specificity: Reacts with lactate dehydrogenase C.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LDHC
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
• Application Notes: This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lactate Dehydrogenase C Antibody (2C8) - Azide and BSA Free

• Cancer/testis antigen 32
• CT32EC 1.1.1.27
• EC 1.1.1
• lactate dehydrogenase C
• lactate dehydrogenase C4
• LDH testis subunit
• LDH3MGC111073
• LDH-C
• LDHX
• LDH-X
• L-lactate dehydrogenase C chain

Background

Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LDHC
• Entrez:
  • 3948(Human)
• Uniprot:
  • NP_002292.1(Human)