Lactase-like Protein/LCTL Antibody

Images

 
Western Blot: Lactase-like Protein/LCTL Antibody [NBP2-87715] - Host: Rabbit. Target Name: LCTL. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lactase-like Protein/LCTL Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human Lactase-like Protein/LCTL. Peptide sequence: LPVFSLQEKSYIKGTSDFLGLGHFTTRYITERNYPSRQGPSYQNDRDLIE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
LCTL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lactase-like Protein/LCTL Antibody

  • FLJ33279
  • KLG
  • klotho gamma
  • Klotho/lactase-phlorizin hydrolase-related protein
  • KLPH
  • KLPHKL lactase phlorizin hydrolase
  • Lactase like Protein
  • Lactase-like Protein
  • lactase-like
  • LCTL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
DF1900
Species: Hu
Applications: ELISA
AF2619
Species: Mu
Applications: WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-31308
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-00932
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF2619
Species: Mu
Applications: WB
MAB859
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, KO
NBP3-12238
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF3034
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
MF2100
Species: Mu, Rt
Applications: ELISA
NBP1-84597
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-87441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4499
Species: Hu, Mu, Rt
Applications: Simple Western, WB
MAB9167
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP2-87715
Species: Hu
Applications: WB

Publications for Lactase-like Protein/LCTL Antibody (NBP2-87715) (0)

There are no publications for Lactase-like Protein/LCTL Antibody (NBP2-87715).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lactase-like Protein/LCTL Antibody (NBP2-87715) (0)

There are no reviews for Lactase-like Protein/LCTL Antibody (NBP2-87715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lactase-like Protein/LCTL Antibody (NBP2-87715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lactase-like Protein/LCTL Products

Bioinformatics Tool for Lactase-like Protein/LCTL Antibody (NBP2-87715)

Discover related pathways, diseases and genes to Lactase-like Protein/LCTL Antibody (NBP2-87715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lactase-like Protein/LCTL Antibody (NBP2-87715)

Discover more about diseases related to Lactase-like Protein/LCTL Antibody (NBP2-87715).
 

Pathways for Lactase-like Protein/LCTL Antibody (NBP2-87715)

View related products by pathway.

Blogs on Lactase-like Protein/LCTL

There are no specific blogs for Lactase-like Protein/LCTL, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lactase-like Protein/LCTL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCTL