Lactase-like Protein/LCTL Antibody - BSA Free

Western Blot: Lactase-like Protein/LCTL Antibody [NBP2-87715] - Host: Rabbit. Target Name: LCTL. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Lactase-like Protein/LCTL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Lactase-like Protein/LCTL Antibody - BSA Free (NBP2-87715) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human Lactase-like Protein/LCTL. Peptide sequence: LPVFSLQEKSYIKGTSDFLGLGHFTTRYITERNYPSRQGPSYQNDRDLIE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LCTL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Lactase-like Protein/LCTL Antibody - BSA Free

• FLJ33279
• KLG
• klotho gamma
• Klotho/lactase-phlorizin hydrolase-related protein
• KLPH
• KLPHKL lactase phlorizin hydrolase
• Lactase like Protein
• Lactase-like Protein
• lactase-like
• LCTL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LCTL