KY Recombinant Protein Antigen

Images

 
There are currently no images for KY Recombinant Protein Antigen (NBP2-48660PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KY Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KY.

Source: E. coli

Amino Acid Sequence: EYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSGEFDHAWNAVYLEGRWHL

Protein/Peptide Type
Recombinant Protein Antigen
Gene
KY
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48660.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KY Recombinant Protein Antigen

  • kyphoscoliosis peptidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005555-P01
Species: Hu
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005542-R06
Species: Hu
NB110-61626
Species: Hu
Applications: WB, IHC-P, IP
MAB6967
Species: Hu
Applications: WB
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
MAB5170
Species: Hu
Applications: WB, Simple Western, Block
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF6387
Species: Hu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KY Recombinant Protein Antigen (NBP2-48660PEP) (0)

There are no publications for KY Recombinant Protein Antigen (NBP2-48660PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KY Recombinant Protein Antigen (NBP2-48660PEP) (0)

There are no reviews for KY Recombinant Protein Antigen (NBP2-48660PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for KY Recombinant Protein Antigen (NBP2-48660PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KY Products

Bioinformatics Tool for KY Recombinant Protein Antigen (NBP2-48660PEP)

Discover related pathways, diseases and genes to KY Recombinant Protein Antigen (NBP2-48660PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KY Recombinant Protein Antigen (NBP2-48660PEP)

Discover more about diseases related to KY Recombinant Protein Antigen (NBP2-48660PEP).
 

Pathways for KY Recombinant Protein Antigen (NBP2-48660PEP)

View related products by pathway.

PTMs for KY Recombinant Protein Antigen (NBP2-48660PEP)

Learn more about PTMs related to KY Recombinant Protein Antigen (NBP2-48660PEP).

Blogs on KY

There are no specific blogs for KY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KY Antibody
NBP1-93859
KY Antibody
NBP1-93859
KY Antibody
NBP1-93859
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KY Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KY