Kv7.2 Antibody - BSA Free

Western Blot: Kv7.2 Antibody [NBP2-85192] - Lanes: 100 ug CHO cell lysate. Primary Antibody Dilution: 1:1000. Secondary Antibody: Goat anti-rabbit HRP. Secondary Antibody Dilution: 1:25000. Gene Name: KCNQ2. Submitted by: Anonymous.

Immunohistochemistry: Kv7.2 Antibody [NBP2-85192] - Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5ug/ml using anti-KCNQ2 antibody

Western Blot: Kv7.2 Antibody [NBP2-85192] - Host: Mouse. Target Name: KCNQ2. Sample Tissue: Mouse Pancreas. Antibody Dilution: 1ug/ml

Western Blot: Kv7.2 Antibody [NBP2-85192] - WB Suggested Anti-KCNQ2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate

• Reactivity: Hu, Mu, Ha
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Kv7.2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kv7.2 Antibody - BSA Free (NBP2-85192) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human Kv7.2. Peptide sequence: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNQ2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Kv7.2 Antibody - BSA Free

• BFNC
• BFNS1
• EBN
• EBN1
• EIEE7
• ENB1
• HNSPC
• KCNA11
• KCNQ2
• KQT-like 2
• Kv7.2
• KVEBN1
• neuroblastoma-specific potassium channel protein
• Neuroblastoma-specific potassium channel subunit alpha KvLQT2
• potassium voltage-gated channel subfamily KQT member 2
• potassium voltage-gated channel, KQT-like subfamily, member 2
• Voltage-gated potassium channel subunit Kv7.2

Background

KCNQs are members of the voltage dependent non inactivating potassium channel family. Currently there are five known KCNQs (KCNQ1 to 5) found in the central nervous system and KCNQ2 and 3 have demonstrated their importance in M current activation. Studies have shown that KCNQ2 and KCNQ3 form heteromultimers that, when formed, substantially increase the M current. Inhibition of M current controls neuron excitability throughout the nervous system as well as the responsiveness to synaptic inputs. Genetic mutations in these proteins have been linked to disorders such as benign familial neonatal convulsions (BFNC), deafness, neuropathic pain and epilepsy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNQ2