Kv4.3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Kv4.3 Antibody - BSA Free (NBP2-87709) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Kv4.3. Peptide sequence: VAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLH The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KCND3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Kv4.3 Antibody - BSA Free
Background
Potassium channels contribute to maintaining cell volume, membrane potential, neuronal excitability and the secretion of transmitters, salt and hormones. Two families of potassium channels have been identified. One family includes the inwardly rectifying potassium channels whereas, the other family includes: voltage gating (Kv); big conductance, calcium activated (BKca); and small conductance, calcium activated (SK) potassium channels. Voltage gated potassium (Kv) channels represent the most complex class of voltage gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence related potassium channel genes (shaker, shaw, shab, and shal) have been identified in Drosophila, and each has been shown to have human homologs. This protein is a member of the potassium channel, voltage gated, shal related subfamily, members of which form voltage activated A type potassium ion channels and are prominent in the repolarization phase of the action potential. This member includes two isoforms with different sizes, which are encoded by alternatively spliced transcript variants of this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, In
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: WB
Species: Hu, Mu
Applications: IP, WB
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IP, RIA, WB
Species: Hu
Applications: WB
Publications for Kv4.3 Antibody (NBP2-87709) (0)
There are no publications for Kv4.3 Antibody (NBP2-87709).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kv4.3 Antibody (NBP2-87709) (0)
There are no reviews for Kv4.3 Antibody (NBP2-87709).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Kv4.3 Antibody (NBP2-87709) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kv4.3 Products
Research Areas for Kv4.3 Antibody (NBP2-87709)
Find related products by research area.
|
Blogs on Kv4.3