Kv1.3 Antibody (1D8) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
KCNA3 (AAH35059, 424 a.a. ~ 523 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV |
| Specificity |
KCNA3 - potassium voltage-gated channel, shaker-related subfamily, member 3 |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
KCNA3 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Kv1.3 Antibody (1D8) - Azide and BSA Free
Background
Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Publications for Kv1.3 Antibody (H00003738-M01) (0)
There are no publications for Kv1.3 Antibody (H00003738-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kv1.3 Antibody (H00003738-M01) (0)
There are no reviews for Kv1.3 Antibody (H00003738-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Kv1.3 Antibody (H00003738-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kv1.3 Products
Research Areas for Kv1.3 Antibody (H00003738-M01)
Find related products by research area.
|
Blogs on Kv1.3