Kv1.3 Antibody (1D8)

Images

 
Western Blot: Kv1.3 Antibody (1D8) [H00003738-M01] - KCNA3 monoclonal antibody (M01), clone 1D8. Analysis of KCNA3 expression in Jurkat.
Western Blot: Kv1.3 Antibody (1D8) [H00003738-M01] - KCNA3 monoclonal antibody (M01), clone 1D8 Analysis of KCNA3 expression in Hela S3 NE.
Western Blot: Kv1.3 Antibody (1D8) [H00003738-M01] - KCNA3 monoclonal antibody (M01), clone 1D8. Analysis of KCNA3 expression in human liver.
Sandwich ELISA: Kv1.3 Antibody (1D8) [H00003738-M01] - Detection limit for recombinant GST tagged KCNA3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Kv1.3 Antibody (1D8) Summary

Immunogen
KCNA3 (AAH35059 424 a.a. - 523 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Specificity
KCNA3 - potassium voltage-gated channel, shaker-related subfamily, member 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KCNA3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kv1.3 Antibody (1D8)

  • HGK5
  • HLK3KV1.3
  • HPCN3PCN3
  • HUKIII
  • Kv1.3
  • MK3
  • potassium channel 3
  • potassium voltage-gated channel subfamily A member 3
  • potassium voltage-gated channel, shaker-related subfamily, member 3
  • type n potassium channel
  • Voltage-gated K(+) channel HuKIII
  • voltage-gated potassium channel protein Kv1.3
  • Voltage-gated potassium channel subunit Kv1.3

Background

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
H00003736-B01P
Species: Hu
Applications: WB
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP2-33694
Species: Hu
Applications: IHC, IHC-P
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP1-89717
Species: Hu
Applications: IHC, IHC-P
NBP2-19315
Species: Hu
Applications: WB
NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NBP1-87231
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Kv1.3 Antibody (H00003738-M01) (0)

There are no publications for Kv1.3 Antibody (H00003738-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv1.3 Antibody (H00003738-M01) (0)

There are no reviews for Kv1.3 Antibody (H00003738-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv1.3 Antibody (H00003738-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv1.3 Products

Bioinformatics Tool for Kv1.3 Antibody (H00003738-M01)

Discover related pathways, diseases and genes to Kv1.3 Antibody (H00003738-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv1.3 Antibody (H00003738-M01)

Discover more about diseases related to Kv1.3 Antibody (H00003738-M01).
 

Pathways for Kv1.3 Antibody (H00003738-M01)

View related products by pathway.

PTMs for Kv1.3 Antibody (H00003738-M01)

Learn more about PTMs related to Kv1.3 Antibody (H00003738-M01).

Blogs on Kv1.3

There are no specific blogs for Kv1.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv1.3 Antibody (1D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNA3
Entrez
OMIM
Uniprot