KTI12 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KTI12 Antibody [NBP2-68622] - Staining of human cell line SK-MEL-30 shows localization to nuclear speckles & cytoplasmic bodies.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KTI12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DQVTSQVLAGLMEAQKSAVPGGLLTLPGTTEHLRFTRPLTMAELSRLRRQFISYTKMHPNNENLPQLANMFLQYLSQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KTI12
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
KTI12 Recombinant Protein Antigen (NBP2-68622PEP)

Reactivity Notes

Mouse 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for KTI12 Antibody

  • KTI12 homolog, chromatin associated (S. cerevisiae)
  • MGC20419
  • protein KTI12 homolog
  • RP11-91A18.3
  • SBBI81
  • TOT4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008518-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-43694
Species: Hu
Applications: ICC/IF, IP, WB
2695-SE
Species: Hu
Applications: EnzAct
NBP1-84276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006919-B02P
Species: Hu
Applications: ICC/IF, WB
NBP2-16321
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-93707
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16322
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-91733
Species: Hu
Applications: IHC, IHC-P, WB
H00006920-M08
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF5447
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-85250
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87835
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-34048
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-88014
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KTI12 Antibody (NBP2-68622) (0)

There are no publications for KTI12 Antibody (NBP2-68622).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KTI12 Antibody (NBP2-68622) (0)

There are no reviews for KTI12 Antibody (NBP2-68622). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KTI12 Antibody (NBP2-68622) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KTI12 Products

Bioinformatics Tool for KTI12 Antibody (NBP2-68622)

Discover related pathways, diseases and genes to KTI12 Antibody (NBP2-68622). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KTI12 Antibody (NBP2-68622)

Discover more about diseases related to KTI12 Antibody (NBP2-68622).
 

Pathways for KTI12 Antibody (NBP2-68622)

View related products by pathway.

PTMs for KTI12 Antibody (NBP2-68622)

Learn more about PTMs related to KTI12 Antibody (NBP2-68622).

Blogs on KTI12

There are no specific blogs for KTI12, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KTI12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KTI12